KEGG   Staphylococcus epidermidis RP62A: SERP2214Help
Entry
SERP2214          CDS       T00229                                 

Definition
(GenBank) hypothetical protein
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AAW53047
UniProt: Q5HKX3
Position
2251642..2251923
Genome map
AA seq 93 aa AA seqDB search
MISIYITYFLSFSNPFAIFILIITAVSVSYKIAKNLLDHMYKNEDRFLALHRNYEKEKLL
FLTLPIIGLITIIGSSFLFDYLIFKLNNTSVEI
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
ttgatttcaatttatattacatattttttaagtttttccaatccatttgcaatttttata
ttaataattacagctgtgtcagtttcttataaaattgctaaaaatctattggatcacatg
tacaaaaatgaggatagatttctagcattacatagaaactacgaaaaggaaaaactatta
tttcttactttacctattattggactcataactataataggaagttcatttctcttcgat
tatttaatatttaaactgaataatacgtctgtagaaatatga

DBGET integrated database retrieval system