KEGG   Staphylococcus epidermidis RP62A: SERP2222Help
Entry
SERP2222          CDS       T00229                                 

Gene name
cadC
Definition
(GenBank) transcriptional regulator CadC
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_5 HTH_24
Motif
Other DBs
NCBI-ProteinID: AAW53062
UniProt: Q5HKW6
Position
2258429..2258776
Genome map
AA seq 115 aa AA seqDB search
MSYENACDVIYVHEDKVNNALSFLEDDKSKKLLNILKKICDEKKLKIILSLIKEDELCVC
DISLILKMSIASTSHHLRLLYKNEVLDFYKDGKMAYYFIKDDEIREFFSKNQKVF
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgagctatgaaaatgcttgtgatgtgatctatgtacatgaggataaagttaacaatgct
ttaagttttttagaagatgataaatctaagaaattacttaacattttaaaaaaaatttgt
gatgagaaaaaattgaaaatcatattatctttgattaaagaagatgagttgtgtgtttgt
gatatttctttgatattgaaaatgagtattgcttcaacttcacatcatttaagactttta
tataaaaatgaggtgcttgatttttataaagatggaaagatggcatattattttattaaa
gacgatgaaataagagagtttttctctaaaaatcagaaggttttttga

DBGET integrated database retrieval system