KEGG   Staphylococcus epidermidis RP62A: SERP2223Help
Entry
SERP2223          CDS       T00229                                 

Definition
(GenBank) hypothetical protein
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AAW53070
UniProt: Q5HKW5
Position
complement(2259315..2259416)
Genome map
AA seq 33 aa AA seqDB search
MSDLLLLPDLKTIEPPQENESDMMFKVEATFPP
NT seq 102 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacttattattactaccagatcttaaaacaatagaaccaccacaagaaaatgaa
tccgacatgatgtttaaagtggaagcaacttttccaccataa

DBGET integrated database retrieval system