KEGG   Staphylococcus epidermidis RP62A: SERP2253Help
Entry
SERP2253          CDS       T00229                                 

Definition
(GenBank) peptidase, M20/M25/M40 family
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ser00300  Lysine biosynthesis
ser01100  Metabolic pathways
ser01120  Microbial metabolism in diverse environments
ser01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ser00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    SERP2253
Enzymes [BR:ser01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     SERP2253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 APG17
Motif
Other DBs
NCBI-ProteinID: AAW53097
UniProt: Q5HKT9
Position
complement(2282118..2283362)
Genome map
AA seq 414 aa AA seqDB search
MSVLSNEERVKILSDIVSIKTVNSNELEVAHYFKRLFSQYGIRSHIDTVTDGRANLIATV
GSSQPVIGISGHMDVVSEGNHDDWTYDPFTLTENQGYLYGRGAADMKSGLAALAIALIEI
KESGKLTQGTIKFMATVGEEMEQSGSQQLFEKGYADDLDALLIAEPSFPSLVYAHKGSMD
FRIKSKGRASHSSIPFLGQNAIKPLLEFIQNINQEYEKIMQTVKGESLDFSNMINKLENQ
LPSHITKEKAQELIQGLVMTNSIVQGGTQVNSVPDFATAEFNVRTIPEYNNNKVKALFNE
YIEQANHNGASLTQELYLDLEPVVTTGQNRLVELGFDIAKSHFSNERDLIITPTVAVTDA
SNLLKGKDENFPFLMFGPGNGPHQINECVEKANYLEFVEYYIEFITSYLNEENE
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtattatctaatgaagaaagagttaaaatcttatccgatatagtctcaataaaa
actgtaaatagcaatgaattagaggttgcacattattttaaaagactatttagtcagtat
ggaattcgttcacatattgatacagttacagatggtcgagcaaatttaatagcaactgtt
ggttcaagtcaaccagttataggaatatctggtcatatggatgtagtatctgaggggaat
catgatgattggacgtatgatccttttacactcacagagaatcaaggatatttatatggt
agaggtgctgcggatatgaaatctggattagcagctttagccattgctcttattgaaatt
aaagaaagtggtaagttaacacagggaactattaaattcatggcaacagtgggtgaagaa
atggaacaatcaggttcgcaacagttgtttgaaaaaggatatgctgatgatttagatgcc
ttactcatagcagaaccatcatttcctagtttggtgtatgcacataaaggttcaatggat
tttagaattaaatctaagggacgtgcatcacacagttcaataccatttttaggacaaaat
gctattaaaccattattagagtttattcaaaatataaatcaagaatatgaaaaaattatg
caaacagtaaaaggtgagtccttagatttttcaaatatgattaataaattagagaatcaa
ttacctagccatataacaaaggaaaaggcacaagagcttattcaaggacttgttatgact
aatagtattgttcaagggggaacacaagttaattcagtacctgattttgcaacagctgaa
tttaatgtacgcacaataccagaatataataataacaaagttaaagcgctatttaatgaa
tatatagagcaagcaaatcacaatggtgctagtttgactcaagaactttatcttgattta
gaacctgtagtaacaacaggtcaaaatcgcttggtagagctagggtttgatattgcaaaa
agccatttttctaacgaaagagatttaatcattactcctactgtagcagttactgatgct
tccaacttattaaaaggaaaagatgaaaattttccatttttaatgtttggcccaggaaat
ggacctcatcaaataaatgagtgcgtagaaaaagccaattatttagaatttgtggaatac
tatatagagtttatcacttcatatttaaatgaagagaatgagtaa

DBGET integrated database retrieval system