KEGG   Staphylococcus epidermidis RP62A: SERP2257Help
Entry
SERP2257          CDS       T00229                                 

Definition
(GenBank) oxidoreductase, short-chain dehydrogenase/reductase family
  KO
K03366  meso-butanediol dehydrogenase / (S,S)-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.- 1.1.1.76 1.1.1.304]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ser00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    SERP2257
Enzymes [BR:ser01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.76  (S,S)-butanediol dehydrogenase
     SERP2257
    1.1.1.304  diacetyl reductase [(S)-acetoin forming]
     SERP2257
    1.1.1.-  
     SERP2257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR 3HCDH_N TrkA_N 3Beta_HSD Ubie_methyltran GDP_Man_Dehyd
Motif
Other DBs
NCBI-ProteinID: AAW53109
UniProt: Q5HKT5
Position
complement(2285934..2286722)
Genome map
AA seq 262 aa AA seqDB search
MVLLSNSKKVAVVTGAAQGIGLKIAERLFEDGYSIALVDFNEEVAKESAEKLSKEGQEAV
AFKADVSNRDQVFSVLNQVVEHFGDLNVLVNNAGLGPMTPIESVTPEQFNQVVGVNVGGV
FWGIQAAIEQFDKLGHGGKIINATSQAGVEGNAGLSLYSSTKFAVRGLTQVAARDLAEKN
ITVNAFAPGIVETPMMKGIAEKLAEENNQPMEWGWKQFTDQIALKRLSKPEDVANVVSFL
AGSDSDYITGQTIIVDGGMRFH
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
gtggttttgttgagtaactcaaaaaaagtagccgttgtcacaggtgcagcacaaggtatt
ggcttgaaaattgctgagcgtctatttgaagacggatatagcatcgcgcttgtagacttt
aatgaagaggtagctaaagagtcagctgaaaaattatcaaaagaagggcaagaggcagtt
gcttttaaagcagacgtttcaaatcgcgatcaagtatttagtgtgttaaatcaagtcgtt
gaacactttggcgatttaaatgtcctagttaataatgctggtcttggaccaatgacacca
attgaatcagtaacacctgaacaatttaatcaagttgtaggtgttaacgtaggtggtgta
ttctggggtatccaagctgcaattgaacaatttgataaattaggacatggcggtaaaatt
atcaatgccacatctcaagcaggtgttgaaggtaatgctggcttatctctatatagcagt
actaagtttgctgttagaggattgactcaagtagcagcacgtgatttagctgagaaaaat
attacagtcaacgcattcgcacctggtattgttgaaacaccaatgatgaaaggtatcgct
gaaaagcttgctgaggaaaataaccaaccaatggaatggggttggaaacaatttacagat
caaattgccttaaaacgcttatctaaacctgaagatgtagctaatgtagtaagcttctta
gcaggtagcgattcagattatattactggccaaacaatcatcgttgacggtggtatgaga
ttccactaa

DBGET integrated database retrieval system