KEGG   Staphylococcus epidermidis RP62A: SERP2259Help
Entry
SERP2259          CDS       T00229                                 

Definition
(GenBank) transcriptional antiterminator, BglG family
  KO
K02538  activator of the mannose operon, transcriptional antiterminator
Organism
ser  Staphylococcus epidermidis RP62A
Brite
KEGG Orthology (KO) [BR:ser00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ser03000]
    SERP2259
Transcription factors [BR:ser03000]
 Prokaryotic Type
  Other transcription factors
   BglG family
    SERP2259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRD PTS_EIIA_2 HTH_11 HTH_Mga PTS_IIB HTH_DeoR PuR_N GerE
Motif
Other DBs
NCBI-ProteinID: AAW53111
UniProt: Q5HKT3
Position
2287464..2289335
Genome map
AA seq 623 aa AA seqDB search
MIDRQIKLIKLLLNYTDTYISGYDIAKQLNVSNRTIRNDIKTIHTTFLNELILSVQSKGY
MLNTCLYTPDEIQSALESVIVKENKLLITIAYRLFMEKHTFTIKELSSTYHLTKSKVIDY
VTRIQTWAIKFDIYLSIKKKQGIMIDASTTSISNAVLHINQLTDDDFKVENLILQELPQA
HTRKIKQIISKHIDNHQLSTSENKIQQLLVHLILIIKHSQPEEEDWSTDTESLTIAKKCI
KDINETLGYQLNNKTSECFSFFISYHFNKFDLGIQQLFIQSYIDRLIELMEQHIGFPFSQ
DTILKDNMNVHFSRTYLRLMSHVYLNNPLTSQIKRLYPFVFNTLYDSIRQLSQDTNIQLS
EDEIAFLTIHFQSSIERHKSSHIHVVIACYYGLGISTLLAEKIKQLNHAIQIVDTLKLED
INNYHFEGIDLLITTHDFDTSQLLQIPKVIQVSPLFSDEDAKKIEFFVKAMQNPLSKDDI
LSKIQLSVESNFKLNHSNHILPIFEKSKEILDYHHATLDGYIESAIDREKQSSTYIGKGI
ALPHGNPEKVLKSHMIIFKPSQPITWKQHEVKLVFFLAMSKKDLNINRKIIQSIAQLEED
DIHQLCLLDDLQLKNTLYARFKE
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
gtgattgatagacaaatcaaactcatcaaattgttattaaattatacagatacgtatata
agtggctatgatattgccaaacagttaaatgtatctaatagaactatacgtaatgatatt
aaaactatacatactacatttttaaatgaattaattttaagtgtacaatctaaaggttat
atgctaaatacatgtctttatacacctgatgagatacaatctgctttagagtcagttatt
gtaaaagagaataaattgcttatcacaattgcttataggttatttatggaaaagcataca
ttcactatcaaagagctatcttcaacttaccatttaacaaaatcaaaagtgattgattat
gtaacacgtatacaaacgtgggctataaaatttgatatttatttatcaattaaaaagaag
caaggtatcatgatcgatgcgagtacaacgagtatcagtaatgctgtacttcatatcaat
caacttacagacgatgactttaaagttgaaaaccttattttacaagagttacctcaagcc
catactagaaaaataaaacaaattatctcaaagcatatagataatcatcaattatcaact
tctgaaaataaaatacaacaattacttgtgcatctaattttaattatcaaacattctcaa
ccagaggaagaagattggagcactgatacagaatctttaactattgcgaaaaagtgtata
aaagatatcaatgaaacccttggatatcaacttaacaataaaacaagtgaatgcttttcc
ttttttattagctaccatttcaataagtttgatttagggatccaacaactatttattcaa
agttatatcgatcgactcattgaattaatggagcaacatattggttttcccttttcacaa
gatacaattttaaaagataatatgaacgtccactttagtcgtacatatttgcgattaatg
agtcatgtttatctaaataatccattaacaagtcaaatcaaacgactatatccctttgtc
tttaatacactatatgatagtattcgacaattatcacaagataccaatatccaattaagc
gaagatgagattgcctttttaactatacattttcagtcttctatcgaacgccataagtca
tcacatattcatgttgtaattgcttgttattatggcttaggcatttcaacgttgcttgct
gagaaaatcaaacaacttaatcatgcaatacagatcgtagatacattaaaacttgaagat
attaataactatcattttgaagggattgacttattaattactactcacgactttgataca
agtcaacttttacaaatacctaaagtcatacaagtatcacctttattttcagatgaagat
gctaaaaaaatcgaattctttgtaaaagccatgcaaaacccattatcaaaagatgatata
ttatcaaaaattcagttgagtgttgagtccaatttcaaactgaatcattcaaatcacatt
cttccaatttttgagaaatccaaagaaattttagattatcatcatgcaactctagatggc
tatatagaaagtgccatagatcgcgaaaaacaatcttcaacatatataggtaaagggata
gcactcccacacggcaaccctgaaaaagtactgaaatcacacatgattatatttaaacct
tctcaacctataacatggaaacaacatgaagttaaacttgttttctttttagcaatgagt
aaaaaagatttaaatattaaccgtaaaattatacaatcaattgctcaattagaagaagat
gacatccatcaattatgtcttttagatgatttacaactaaaaaacactttgtatgcacgt
tttaaagaataa

DBGET integrated database retrieval system