KEGG   Staphylococcus epidermidis RP62A: SERP2264Help
Entry
SERP2264          CDS       T00229                                 

Definition
(GenBank) cell wall surface anchor family protein
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 Gram_pos_anchor CutA1 FliG_N
Motif
Other DBs
NCBI-ProteinID: AAW53125
UniProt: Q5HKS8
Position
complement(2298118..2300148)
Genome map
AA seq 676 aa AA seqDB search
MKRTDKIGVYLKLSCSALLLSGSLVGYGFTKDAFADSESTSSNVENTSNSNSIADKIQQA
KDDIKDLKELSDADIKSFEERLDKVDNQSSIDRIINDAKDKNNHLKSTDSSATSSKTEDD
DTSEKDNDDMTKDLDKILSDLDSIAKNVDNRQQGEERASKPSDSTTDEKDDSNNKVHDTN
ASTRNATTDDSEESVIDKLDKIQQDFKSDSNNNPSEQSDQQASPSNKTENNKEESSTTTN
QSDSDSKDDKSNDGHRSTLERIASDTDQIRDSKDQHVTDEKQDIQAITRSLQGSDKIEKA
LAKVQSDNQSLDSNYINNKLMNLRSLDTKVEDNNTLSDDKKQALKQEIDKTKQSIDRQRN
IIIDQLNGASNKKQATEDILNSVFSKNEVEDIMKRIKTNGRSNEDIANQIAKQIDGLALT
SSDDILKSMLDQSKDKESLIKQLLTTRLGNDEADRIAKKLLSQNLSNSQIVEQLKRHFNS
QGTATADDILNGVINDAKDKRQAIETILQTRINKDKAKIIADVIARVQKDKSDIMDLIHS
AIEGKANDLLDIEKRAKQAKKDLEYILDPIKNRPSLLDRINKGVGDSNSIFDRPSLLDKL
HSRGSILDKLDHSAPENGLSLDNKGGLLSDLFDDDGNISLPATGEVIKQHWIPVAVVLMS
LGGALIFMARRKKHQN
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgaagagaacagataaaattggtgtctacctcaagctgtcatgttctgcgttgttactt
agtggttcgctggttggttatggcttcacaaaagatgcttttgcagattcagaaagtaca
tcatcaaatgttgaaaatacttctaatagtaactccatcgctgacaaaatccaacaagct
aaagatgatattaaagatttgaaagaactttctgacgcagatatcaaaagttttgaagaa
cgtttagataaagtcgataatcaatcaagtattgaccgtattataaatgatgcaaaagat
aaaaataatcatttaaaatcgacagactctagtgccacatcatcaaaaactgaagatgac
gatacatctgaaaaagataatgatgatatgactaaagacttagataaaatactgtcggat
ttagattcaattgctaaaaatgttgataaccgtcaacaaggtgaagagagagcttctaaa
cctagtgactcaacaaccgatgaaaaagatgattcaaataataaagtacacgatacaaat
gctagtacacgtaatgcaactactgatgattctgaagagtcggttattgataaattagat
aaaatccaacaagattttaaatctgactctaataataatccttctgaacaaagcgatcag
caagcatcaccatctaataaaaccgaaaataacaaagaagaatctagtacgacaacaaat
caatccgatagtgatagtaaagacgataaaagtaatgatggtcatcgctcaacattagaa
cgtatagcatcagatactgatcaaattagggattcaaaagatcaacatgtcacagatgaa
aaacaagatatacaagcaattacacgttcattacaaggtagtgataagattgaaaaagca
cttgctaaggtacaatctgacaatcaatcactagattctaattatataaataataaatta
atgaatttaagatcactagatacaaaagtagaggataataacactttatctgatgataag
aaacaagcgcttaaacaagaaattgataagactaagcaaagtattgaccgacaaagaaat
attattatagatcaactcaatggtgctagtaataaaaaacaagcaaccgaagatatctta
aatagtgtttttagcaaaaatgaagtagaagacataatgaaacgtattaaaacaaatggc
cgaagtaatgaagatatcgctaatcaaattgccaagcaaattgatggtcttgcattaact
tctagtgatgatattttaaaatcaatgttagatcaatctaaagataaagaaagtttaatt
aaacaattgttgacgacacgacttggtaatgatgaagcagatcgtattgctaaaaaattg
ttaagccaaaacttgtcgaattctcaaattgtagaacaattaaaacgtcatttcaatagt
caaggaacagctacagctgatgatatattgaatggtgtgattaatgatgctaaagacaaa
agacaagcgattgaaacaatattacaaacccgtatcaataaagacaaagctaaaattatc
gctgatgttattgcgcgtgtacaaaaggacaaatcagatatcatggatctcattcactct
gcgattgaaggcaaggcaaatgatttattagatatagaaaaacgagcaaaacaagctaag
aaagatttagaatatattttagatcctataaagaatagaccatccttgttagatcgtatt
aacaaaggtgtcggtgattctaattcaatatttgatagaccaagtttacttgataaactt
cactcaagaggatctattcttgataaattagatcattcggcaccggagaatggattatct
ttagataataaaggtggccttttaagtgatctatttgacgacgatggtaatatctcatta
ccagcgacaggtgaagtcatcaaacaacattggataccagtggctgttgtactcatgtca
ttaggtggggcgctcatctttatggcgcgtagaaaaaaacaccaaaattaa

DBGET integrated database retrieval system