KEGG   Staphylococcus epidermidis RP62A: SERP2266Help
Entry
SERP2266          CDS       T00229                                 

Definition
(GenBank) hypothetical protein
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AAW53127
UniProt: Q5HKS6
Position
complement(2300851..2301039)
Genome map
AA seq 62 aa AA seqDB search
MKFFKKYEIDLKKDILFMKSKLNERLEIKNRDCGSMKVYKKSRTEFNLNSLFYSLILYRN
IC
NT seq 189 nt NT seq  +upstreamnt  +downstreamnt
gtgaaattttttaaaaagtatgaaattgatttaaaaaaagatattttgtttatgaaaagt
aaattgaatgagagattggaaattaaaaacagagactgtggaagtatgaaagtatataaa
aagagtagaacagaattcaatttgaattcattattctactctttaatcttgtatagaaac
atttgctaa

DBGET integrated database retrieval system