KEGG   Staphylococcus epidermidis RP62A: SERP2272Help
Entry
SERP2272          CDS       T00229                                 

Definition
(GenBank) peptide methionine sulfoxide reductase, putative
  KO
K07304  peptide-methionine (S)-S-oxide reductase [EC:1.8.4.11]
Organism
ser  Staphylococcus epidermidis RP62A
Brite
KEGG Orthology (KO) [BR:ser00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SERP2272
Enzymes [BR:ser01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.11  peptide-methionine (S)-S-oxide reductase
     SERP2272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PMSR
Motif
Other DBs
NCBI-ProteinID: AAW53141
UniProt: Q5HKS0
Position
complement(2304937..2305416)
Genome map
AA seq 159 aa AA seqDB search
METVYFAGGCLWGTQAFFNTIPGVIQTEAGRANGTSKCLDAPYDGYAECVKIHFDPAKTS
ILMLMDYLFEMINPYSLNQQGQDKGQKYRTGVYSESSKHLNEAKDYIKRREDAKQVMVEV
QPLSNYVKSAEEHQNHLEKFPEDYYLCHVPPALLNKYKK
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atggaaacggtatattttgctggtggatgtctatggggaactcaagctttttttaatacg
attccaggagttattcaaacagaagctggaagggcaaatggaacgtcgaaatgtttagat
gctccttatgatggctatgctgaatgtgtgaagatacactttgatcctgcaaaaacttca
atacttatgctgatggattatttgtttgaaatgataaatccttatagtttaaatcaacaa
ggtcaagacaagggtcaaaaatatcgaacaggtgtgtatagtgaaagttcgaagcattta
aatgaagcaaaagactacattaagcgcagggaagacgcgaaacaagtaatggtcgaagta
caacctctaagtaattatgtgaagagtgcagaagaacatcagaatcatcttgagaaattt
ccggaggattattatttatgtcatgttcctccagcattgcttaataaatacaagaaataa

DBGET integrated database retrieval system