KEGG   Staphylococcus epidermidis RP62A: SERP2275Help
Entry
SERP2275          CDS       T00229                                 

Definition
(GenBank) glycosyl transferase, group 1 family protein
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_1 Glyco_trans_1_4
Motif
Other DBs
NCBI-ProteinID: AAW53144
UniProt: Q5HKR7
Position
complement(2307372..2308880)
Genome map
AA seq 502 aa AA seqDB search
MTIYNINFGIGWASSGVEYAQVYRAKLLRQLPYPTKFIFLDFIQSENIQTLTSNIGFKDD
EVIWLYQYFTDVKIAPTTYTVDDLISELGNEVTRKEQNGKVLRLYLNNQQTFVTCYLKNA
NEHYVDRAEFVVNGMLIRKDFYSYVRTFSEYYAPFNNKAKIYMRQFYNENGSIAYREYID
EDEHVFVFDDARLYSKQALVAYFIRQLLLNSEDIIIIDRATDVGQAILENKGSSKVGVVV
HAEHFSEGATDGTHILWNNYYEYQFENAQHIDFFITATDLQRQTLSEQFKQYKNDCPRIR
TIPVGSIESLQYPEKERKPYSIMTASRLANEKHVDWIVEAVIKAKHQLPQLSFDIYGQGE
EQEKIKNIITKHRAEDYIQIKGHRNLRTIYQQYELFIAASQSEGFGLTLMEAVGSGLGMI
GFDVNYGSPTFIRHHQNGYLIPINFEQASTDDITTQIAHMIIRYFEDGPIRAHEVSYDIA
ESFKTSHIVDLWRQLIEEVLYD
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgacgatttataatatcaattttggaatcggttgggccagtagtggtgttgaatatgca
caagtgtatcgagcaaaactattaaggcaattaccttatccaacaaaatttatattttta
gattttattcaatcagaaaatattcaaacactcacaagcaacatagggtttaaagatgat
gaagttatttggctatatcaatacttcacagacgtaaaaatcgctcctacaacgtacaca
gttgatgatttaatttcagagttaggtaatgaggttactcgaaaagaacaaaacggtaaa
gtattacgactctatttaaataatcagcaaacattcgtaacctgctatttaaaaaatgct
aacgaacattacgttgatcgtgcagagtttgtggtgaatggaatgttaattaggaaagat
ttttatagctatgtaagaacattctcggagtattatgctccttttaacaataaagctaaa
atatatatgcgtcaattttataatgaaaatggatcaattgcatatcgcgaatatatagat
gaagatgaacatgtttttgtgtttgatgatgcacgtttatacagtaaacaagcactcgtc
gcatactttatacgtcaattgctattgaattcagaggatatcattattattgatcgagca
actgatgtgggacaagccatattagaaaacaagggatccagtaaagttggcgtagtcgtt
cacgctgaacatttcagtgaaggtgcgactgatgggactcacattttatggaataattat
tatgagtatcaattcgaaaatgcacagcatattgatttctttatcacagcgacagatttg
caaaggcagacactaagtgaacaatttaaacaatataagaatgattgtccacgtatacgt
acaattccagtaggtagtatagaatcgttacaatatcctgaaaaagaaagaaaaccatat
tccatcatgaccgcatcacgtcttgctaacgaaaaacatgttgattggatagtggaagct
gtgattaaagctaaacatcagttacctcaattgagttttgatatctacggacaaggagaa
gaacaagaaaaaattaaaaatattattaccaaacatcgtgctgaggattacatacaaatt
aaaggacatagaaatcttcgtacaatatatcagcaatatgaattattcatagcggcctca
caaagtgaagggttcggactgacattaatggaagcggttggctctggtttaggtatgatt
ggatttgatgtgaattatggcagtccgacatttattcgacatcatcaaaatggctatttg
ataccgataaattttgaacaagcgtctactgatgatatcacaacgcaaatcgctcatatg
attattcgatattttgaagatggtcccataagggcacatgaggtatcgtatgacattgca
gaatcatttaaaacatcgcatattgttgatctatggagacaactcattgaagaggtgcta
tatgattaa

DBGET integrated database retrieval system