KEGG   Staphylococcus epidermidis RP62A: SERP2276Help
Entry
SERP2276          CDS       T00229                                 

Definition
(GenBank) secA family protein
  KO
K03070  preprotein translocase subunit SecA
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ser02024  Quorum sensing
ser03060  Protein export
ser03070  Bacterial secretion system
Module
ser_M00335  Sec (secretion) system
Brite
KEGG Orthology (KO) [BR:ser00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    SERP2276
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SERP2276
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SERP2276
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ser02044]
    SERP2276
Secretion system [BR:ser02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components [MD:M00335]
   SERP2276
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SecA_DEAD SecA_PP_bind SecA_SW DEAD Helicase_C HSCB_C
Motif
Other DBs
NCBI-ProteinID: AAW53145
UniProt: Q5HKR6
Position
complement(2308898..2311288)
Genome map
AA seq 796 aa AA seqDB search
MAKGVNQIINNIRLRKLRKILNQINALSEEFSNFSDEALQAKTKEFKVYLNDNKASLNHI
LPQAYATVREASKRVLGMYPKDVQILGAIAMHQGNIAEMQTGEGKTLTATMPLYLNALTG
KGAYLITTNDYLAKRDFLEMKPLYEWLGLSVSLGFVDIPEYEYAENEKYELYHHDIVYTT
NGRLGFDYLIDNLADDIRAKFLPKLNFAIIDEVDSIILDAAQTPLVISGAPRVQSNLFHI
VKTFVETLEKDKDFIVNFNKKEVWLTDEGSEKASHYFKVNSIYQQQYFDLVRMIHLSLRA
KYLFKYNLDYFIFDGEIVLIDRITGRMLPGTKLQSGLHQAIEALENVEISQDMSVMATIT
FQNLFKQFDEFSGMTGTGKLGEKEFFDLYSKVVIEIPTHSPIERDDRPDRVFANGDKKND
AILKTVIGIHETQQPVLLITRTAEAAEYFSAELFKRDIPNNLLIAQNVAKEAQMIAEAGQ
LSAVTVATSMAGRGTDIKLSKEVHDIGGLAVIINEHMDNSRVDRQLRGRSGRQGDPGYSQ
IFVSLDDDLVKRWSNSNLAENKNLQTMDASKLESSALFKKRVKSIVNKAQRVSEETAMKN
REMANEFEKSISVQRDKIYAERNHILEASDFDDFNFEQLARDVFTKDVKNLDLSSERALV
NYIYENLSFVFDEDVSNINMQNDEEIIQFLIQQFTQQFNNRLEVAADSYLKLRFIQKSIL
KAIDSEWIEQVDNLQQLKASVNNRQNGQRNVIFEYHKVALETYEYMSEDIKRKMVRNLCL
SILAFDKDGDMVIHFP
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaggtgttaaccaaattattaataatattaggttaagaaaattgcgcaaaata
ttaaatcaaattaatgcgcttagtgaggagttctcaaattttagtgatgaagcacttcaa
gcgaagacaaaagaatttaaagtttatttaaatgataataaagcttcactcaatcacatt
ctgccacaagcttatgcaacagttagagaggcttctaagcgcgttttaggtatgtatcca
aaagatgtgcagattttaggagcaatcgctatgcatcaggggaatattgcagaaatgcaa
acaggagaaggtaagacgcttacagctaccatgcctctgtacttaaatgcacttacaggt
aaaggtgcttatctaatcacaacaaatgattacttagcaaaacgcgattttttagaaatg
aaaccactatatgaatggctaggcttgtctgtatcattaggatttgtggacattccagaa
tatgaatacgctgaaaatgaaaaatatgaactgtaccaccatgacattgtttacacgact
aatgggcgactagggtttgattatttaattgataatttagctgatgatattcgtgccaaa
tttttaccgaaattaaactttgctattattgatgaagtcgattctattatattagacgct
gcccaaacgcctttagttatttctggtgcaccacgtgtacaatctaatttatttcacatc
gttaaaacgtttgttgaaacacttgagaaagataaagacttcatagttaattttaataaa
aaagaagtgtggctcactgatgagggctcggaaaaagcaagccattatttcaaagtgaat
agtatataccaacagcaatattttgatttagttaggatgattcatttatcgcttagagct
aagtatttattcaaatataatttagactattttatttttgatggtgagattgtgcttata
gatagaataactggtcgtatgctacctggaacaaagcttcagtctggtttacatcaagct
atagaggctctggaaaatgttgaaatttctcaagatatgagtgtgatggcaaccataaca
ttccaaaacttatttaagcaatttgatgaattttcaggtatgactggaacaggtaaatta
ggggaaaaagaattctttgatttatattcaaaagttgttatagagattccgactcacagt
ccgattgaacgagatgatagacctgatagagtatttgctaatggtgacaaaaagaacgat
gcaattttaaagacagtgattggtatacatgaaactcaacaacctgtgttactaattaca
cgtactgcagaagcggcagaatatttttcagctgagttatttaaacgtgatatacccaac
aatttattaatcgctcaaaatgtagctaaagaggcacaaatgattgctgaggcgggacaa
ttatctgcagttactgttgctacaagtatggcagggcgtggaactgatataaagttatca
aaagaggttcatgatatcggtggcttagcagtgattattaatgaacatatggataatagt
cgtgttgatcgtcaattaagaggacgctcaggtcgccaaggagatcctggatattcacag
atttttgtatcacttgatgatgatttagtaaaacgttggagtaactctaacttggcagaa
aataaaaacctccaaacgatggatgcatctaaactagaaagtagtgcactctttaaaaaa
cgtgtaaagtcaattgttaataaagcgcaacgtgtatctgaagagactgctatgaaaaat
agagaaatggcaaatgaattcgaaaaaagtattagtgttcaacgagataaaatttatgct
gaacgtaatcacatacttgaagcaagcgattttgatgattttaattttgaacagcttgca
cgagatgtgtttacaaaagacgttaaaaatcttgacttaagtagtgaacgtgcacttgtg
aattatatatacgaaaacttaagttttgtcttcgatgaagatgtatcaaatattaatatg
caaaatgatgaagaaatcatacaattcttaatacaacaatttactcaacaatttaacaat
cgtttagaagttgctgctgattcatatttaaaacttcgtttcattcaaaaatcaattttg
aaagcgatagatagcgaatggattgaacaagtagataacttacaacaacttaaagccagt
gtaaacaatcgacaaaatggacagcgtaatgtcatttttgaatatcataaagtggctctt
gaaacgtatgaatatatgtctgaagatataaaaaggaagatggttagaaatttatgttta
agtattctagcctttgataaggacggagatatggtcattcatttcccataa

DBGET integrated database retrieval system