KEGG   Serratia sp. ATCC 39006: Ser39006_002165Help
Entry
Ser39006_002165   CDS       T05290                                 

Definition
(GenBank) glucose-1-phosphatase
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
sera  Serratia sp. ATCC 39006
Pathway
sera00010  Glycolysis / Gluconeogenesis
sera01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sera00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ser39006_002165
Enzymes [BR:sera01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     Ser39006_002165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase SHOCT Acid_PPase Hydrolase_like PNK3P HAD
Motif
Other DBs
NCBI-ProteinID: AUH03048
UniProt: A0A2I5TER2
Position
complement(468721..469332)
Genome map
AA seq 203 aa AA seqDB search
MLYIFDLGNVIIDIDFNRVFGVWSHLGNVPLAMLRERFVMGDTFERHERGEISDEEFASR
VCHEVGISLSFEQFSTGWQAIFVSLRAEVLEIMQRLRQEGHRVVILSNTNRLHCDFWPTQ
YPQIQQAVDHLYLSQEIGFRKPEADIYHHVLRQEAVTADNAIFFDDNIANVTAASELGIQ
SILVSDRKVIPDFFAQKYNVFSK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgctgtatatatttgatttgggcaatgtcatcatcgacattgattttaatcgggttttc
ggtgtgtggagccatcttggtaacgtaccgctagcaatgttacgcgaacgtttcgttatg
ggggacacctttgagcggcatgagcgtggcgagatcagtgatgaggaattcgcatcccgc
gtgtgtcatgaagtgggtattagccttagctttgaacagttctcgacggggtggcaagcg
atatttgtttctctgcgggctgaagtattggagattatgcagcgtttgcgtcaggaagga
caccgggtggtcatcctttccaataccaaccgcttgcattgtgatttctggccaactcaa
tatccgcaaatacagcaagccgtagatcatctgtacctttctcaggaaatcggatttcgc
aaaccagaagcggatatttaccaccatgtactgcgccaggaagctgtcacggcggataat
gccattttctttgatgataatattgctaatgtgacggcggcttctgaacttggcattcag
tcgatactggtgagtgaccgaaaggtaatccctgatttttttgcccaaaaatataacgtt
tttagtaaatag

DBGET integrated database retrieval system