KEGG   Serratia sp. ATCC 39006: Ser39006_010805Help
Entry
Ser39006_010805   CDS       T05290                                 

Gene name
ggt
Definition
(GenBank) gamma-glutamyltransferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
sera  Serratia sp. ATCC 39006
Pathway
sera00430  Taurine and hypotaurine metabolism
sera00460  Cyanoamino acid metabolism
sera00480  Glutathione metabolism
sera01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sera00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Ser39006_010805 (ggt)
   00460 Cyanoamino acid metabolism
    Ser39006_010805 (ggt)
   00480 Glutathione metabolism
    Ser39006_010805 (ggt)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sera01002]
    Ser39006_010805 (ggt)
Enzymes [BR:sera01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     Ser39006_010805 (ggt)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     Ser39006_010805 (ggt)
Peptidases and inhibitors [BR:sera01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   Ser39006_010805 (ggt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept DUF3854
Motif
Other DBs
NCBI-ProteinID: AUH04569
UniProt: A0A2I5T6Q4
Position
complement(2344286..2346049)
Genome map
AA seq 587 aa AA seqDB search
MASGKRFLTVSLAALLISGTVHAASIPAVEAKNGMVVSSQHLASQVGIDVLKMGGNAIDA
AVAVGYAQAVVNPCCGNIGGGGFMTIHLANGKNTFINFRETAPAAATAKMYLDADGNVKK
GASLYGYLAAGVPGTVLGLETARKEYGKLSREQVMAPAIKLARKGFILTRYDTDILDTTV
KRFKQDPEAARIFLRPDGSPLQPGDRLVQTDLANTLQAIADHGPDAFYKGKVPQIIADAA
KKGGGILTSADFANYKVTETAPVSCTYRGYNFVSSPPPSSGGTTMCEILNIVEGYDLKSM
GFNSAQSIHILTEAMRHAYMDRNTYLGDPAFVKNPLDRLLSKTYAAEIREKIKPQDATPS
TQVKPGAAPHEKLETTQYSIVDNQGNAVSTTYTINGRFGAGVIAPGTGFFLNDEMDDFTT
KVGAQNLYGLVQGERNAIAPGKRPLSSMSPSLVTKDGKIFLVLGSPGGSRIITITLETAL
NIIDYGMAPQEAVDAPRIHHQWLPDKVYYEQRGLSADTLKLLKERGYDMVEQTPWGAAEL
IMVGLPGAAGVSSASSGNDAAVSGKVREGYLYGANDSRRPSGAAIGY
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaggaaaaaggtttctgacagtcagcctggccgcattgctgatcagtggaacc
gttcatgccgcatctattcccgccgtagaagcaaaaaatggcatggttgtcagttcacag
catcttgcctcacaagtgggcattgatgtgctaaaaatgggcggaaacgccattgatgca
gccgtcgccgttggttatgcccaggctgtggtgaatccgtgctgcggcaacattggtggt
ggtgggttcatgactattcatctggccaatggcaagaacacgtttatcaacttccgtgaa
acagcacccgcagcggcaacagccaaaatgtatctggatgccgacggtaacgtgaagaaa
ggtgccagcctgtacggttacctggctgccggggtgcccggtaccgtactcggtctggaa
accgcgcggaaagagtatggcaagctaagcagggaacaggtaatggcccccgccataaaa
ctggcacgcaaaggtttcatcctgacccgttacgacaccgatattctggataccactgtc
aagcgtttcaaacaggacccggaagccgctcgcattttcctgcgtcctgacggcagcccg
ttacaaccaggtgaccgattggtgcaaaccgatctggccaatacgctacaggcgattgcc
gatcacggcccggatgcgttctataaggggaaagtgcctcaaatcatcgccgacgcagcc
aaaaaaggcggcggaatactgacatcggcagacttcgccaattacaaagtgactgaaacc
gcgccagtcagttgtacttaccgcggctacaactttgtctcttccccaccccctagctcc
ggcggcaccacgatgtgtgaaatactgaatattgttgagggttatgacctgaaaagcatg
ggtttcaactccgcgcagtcaatacacattctgaccgaagccatgcgtcatgcctatatg
gaccgcaacacctatttgggtgatccggcctttgtaaaaaacccactcgatcgactgctg
agcaaaacctatgccgccgagatacgcgaaaaaatcaaaccgcaagacgccacgccttcc
acccaggtgaaacccggggcagcgccgcatgaaaaactggaaaccacgcagtattcgatt
gtcgataatcagggcaacgccgtctctaccacctacaccatcaatggccgtttcggtgcg
ggagtcatcgcccctggtaccggttttttcctcaacgatgaaatggatgatttcacgacc
aaggtcggtgcgcaaaacctgtacggtctggtacaaggagagcgtaacgccattgcgccc
ggtaaacgtccgctgtcatccatgagcccgtcgttggtcaccaaagacggtaaaatattc
ctggtgctgggttcgccgggaggatcgcggatcattaccattactctggaaaccgcactg
aatatcatcgactacggtatggcaccacaagaagcggtggatgcgccacgtattcatcat
caatggttaccggataaggtctattacgagcagcgcggattgtctgctgatacactgaaa
ttattgaaagaacggggttatgacatggtggaacaaacaccgtggggcgcggctgaactg
attatggtcggtctgcctggcgcggcaggcgtctcctcggcatcgtctggcaatgacgcc
gccgtatccggcaaagtccgtgagggatatttgtacggtgccaacgattcacgccgcccg
tccggtgccgctatcggttattga

DBGET integrated database retrieval system