KEGG   Serratia sp. FS14: L085_01120Help
Entry
L085_01120        CDS       T03313                                 

Definition
(GenBank) mandelate racemase/muconate lactonizing protein
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
serf  Serratia sp. FS14
Pathway
serf00051  Fructose and mannose metabolism
serf01100  Metabolic pathways
serf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:serf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    L085_01120
Enzymes [BR:serf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     L085_01120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N MAAL_C ORC6
Motif
Other DBs
NCBI-ProteinID: AIA45688
Position
complement(251211..252488)
Genome map
AA seq 425 aa AA seqDB search
MTTITALRVEDIRFPTSLGLDGSDAMNPDPDYSAAYVILETDRADLSGHGLTFTIGRGNE
ICCAAIRALEHQIVGERLEDIAADMGAFWRRFTSDSQLRWIGPDKGAIHLATGAVVNAVW
DLWAKSVGKPVWRLVAEMTPEELVRCIDFRYITDCITPQEALALLKQRAEGKERRLERLL
QEGYPCYTTSAGWLGYPDDKLRRLCQEAVDAGFSYLKLKVGRDLEDDIRRVRIAREVIGP
DRRLMIDANQVWEVDEAIPWVKHLAFAKPWFIEEPTSPDDVEGHRRIREGVAPVKVATGE
MCQNRIMFKQFIMRGAVDVVQIDACRLGGVNEVLAVMLMAAKYQLPVCPHAGGVGLCEYV
QHLSMIDFLCIAGTHEGRVIEYVDHLHEHFVDPCVINGAAYMPPSRPGYSIEMHPASIEQ
YRFRG
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccattaccgcactgcgggttgaagacattcgtttccccacgtcgctggggctg
gacggatccgacgccatgaatccggatcccgactattccgccgcctacgtgatcctggag
accgatcgcgcggatctcagcggccacgggctgacgttcaccatcgggcgcggcaacgag
atctgctgcgcggcgatccgcgcgctggagcatcagatcgtcggcgagcggctggaggat
atcgccgctgacatgggcgccttctggcggcgcttcaccagcgacagccagctgcgctgg
atcgggccggacaagggcgccattcacctggcgaccggcgcggtggtcaacgcggtgtgg
gatctgtgggccaaatcggtcggcaagccggtatggcggctggtggcagagatgacgccg
gaggagctggtgcgctgcatcgacttccgttacatcaccgactgcatcacgccgcaggaa
gcgctggcgctgctcaagcagcgggccgagggcaaagaacgccgcctggaacggctgctg
caggaagggtatccctgctacaccacttcggcagggtggctgggttatccggacgacaag
ctgcgccgcctgtgccaggaagcggtcgacgccggtttctcctacctgaagctgaaggtc
gggcgcgatctggaagacgacatccgccgggtgcgcatcgcccgcgaggtgatcggcccg
gatcgccggctgatgatcgacgccaaccaggtgtgggaagtcgatgaagccattccgtgg
gtgaaacatctggcgttcgccaagccctggtttatcgaagagccgaccagcccggacgac
gtggaagggcatcgccgcatccgcgaaggggtggcgccggtcaaggtggctaccggcgag
atgtgccagaaccggatcatgttcaagcagttcatcatgcgcggcgcggtggacgtggtg
cagatcgacgcctgtcgcctcggcggcgtcaacgaagtgttggcggtgatgctgatggcg
gccaaataccagctgccggtctgcccgcacgccggcggcgtcgggctgtgcgaatacgtg
cagcacctgtcgatgatcgacttcctgtgcatcgccggcacccacgaaggccgggtgatc
gagtacgtcgatcatctgcatgaacactttgtcgatccctgcgtgatcaacggcgcggcc
tacatgccgccgagccggcccggttactcgatcgagatgcatccggcgtcgatcgagcag
tatcggttccgcgggtga

DBGET integrated database retrieval system