KEGG   Serratia sp. FS14: L085_01405Help
Entry
L085_01405        CDS       T03313                                 

Definition
(GenBank) putative acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
serf  Serratia sp. FS14
Pathway
serf00071  Fatty acid degradation
serf00072  Synthesis and degradation of ketone bodies
serf00280  Valine, leucine and isoleucine degradation
serf00310  Lysine degradation
serf00362  Benzoate degradation
serf00380  Tryptophan metabolism
serf00620  Pyruvate metabolism
serf00630  Glyoxylate and dicarboxylate metabolism
serf00640  Propanoate metabolism
serf00650  Butanoate metabolism
serf00900  Terpenoid backbone biosynthesis
serf01100  Metabolic pathways
serf01110  Biosynthesis of secondary metabolites
serf01120  Microbial metabolism in diverse environments
serf01130  Biosynthesis of antibiotics
serf01200  Carbon metabolism
serf01212  Fatty acid metabolism
serf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:serf00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    L085_01405
   00630 Glyoxylate and dicarboxylate metabolism
    L085_01405
   00640 Propanoate metabolism
    L085_01405
   00650 Butanoate metabolism
    L085_01405
  Lipid metabolism
   00071 Fatty acid degradation
    L085_01405
   00072 Synthesis and degradation of ketone bodies
    L085_01405
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    L085_01405
   00310 Lysine degradation
    L085_01405
   00380 Tryptophan metabolism
    L085_01405
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    L085_01405
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    L085_01405
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    L085_01405
Enzymes [BR:serf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     L085_01405
Exosome [BR:serf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   L085_01405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AIA45745
Position
complement(308163..309347)
Genome map
AA seq 394 aa AA seqDB search
MQQREVVIVAATRTPVGSFHGALAPLTAVELGTAAVQGLLAQSGVAPQQIDEVILGQVLT
AGCGQNPARQTALNAGLPFTTPALTINKVCGSGLKAVHLAVQAIRSGDADAVIAGGQESM
SRSPYLMAGARAGLRLGHAQMVDSVIHDGLWDAFNDYHMGITAENLAEKYAISREEQDRF
ALRSQQKAQAAQQAGRFAQEITPVTVPQPKGEALRVERDEQPRDTSLEALARLRPAFRKE
GTVTAGNASSLNDGAAVVLLMSAEKAAALRLPVLARIAGYASSGVDPAIMGIGPAPAARR
CLEKAGWRLEEVDLIEANEAFAAQALAVGKELGWEAERVNVNGGAIALGHPIGASGCRIL
VSLLFEMQRRGVNKGLAMLCIGGGQGVALAVERP
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgcaacaacgtgaagtggtgatcgtggcggcgacgcgcacgccggtcggcagttttcac
ggcgcgctggcgccgctgacggcggtggaactgggcacggcggcggtgcaggggctgctg
gcgcaaagcggcgtggcgccgcagcagatcgatgaagtgatcctcggccaggtgctgacc
gccggctgcgggcagaatccggcgcgccagaccgcgctgaacgccggactgccgtttacg
acgccggcgctgaccatcaacaaggtgtgcggctccggtttgaaggcggtgcatctggcg
gtgcaggcgatccgcagcggtgacgccgacgcggtgatcgccggcggccaggagagcatg
agccggtcgccttacctgatggccggcgcgcgcgccggcctgcgcctcggtcacgcgcag
atggtggacagcgtgatccacgatggcctgtgggacgcgttcaacgactaccacatgggc
atcaccgccgagaacctggcggagaaatacgccatcagcagagaagaacaagacaggttc
gcgctgcgctcgcagcagaaggcgcaggcggcgcagcaggccgggcgtttcgcgcaggag
atcacgccggtgacggtgccgcagcccaagggcgaagcgctgcgcgtcgagcgcgacgaa
cagccgcgcgacaccagtctggaggcgctggcgcggctgcgcccggcgtttcgtaaagag
ggcacggtgaccgccggcaacgcctcgtcgctcaacgacggcgccgccgtggtgctgctg
atgagcgcggaaaaagccgccgcgctgcgtttgccggtgctggcgcgcatcgccggttac
gcctcgtcgggcgtcgatccggcgatcatgggcatcggcccggcgccggccgcgcgccgc
tgcctggaaaaagccggttggcggctggaggaggtcgatctgatcgaagccaacgaagcc
ttcgccgcgcaggcgctggcggtgggtaaagaactgggctgggaggcggagcgggtcaac
gtcaacggcggagcgatcgcgctggggcatccgatcggcgcgtccggctgtcgcattttg
gtgtcgctgctgttcgaaatgcagcgccgcggggtgaacaaggggctggcgatgctgtgc
atcggcggcgggcagggggtggcgctggcggtagagcgcccgtaa

DBGET integrated database retrieval system