KEGG   Serratia sp. FS14: L085_02740Help
Entry
L085_02740        CDS       T03313                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
serf  Serratia sp. FS14
Pathway
serf03010  Ribosome
Brite
KEGG Orthology (KO) [BR:serf00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    L085_02740 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:serf03011]
    L085_02740 (rplV)
Ribosome [BR:serf03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    L085_02740 (rplV)
  Bacteria
    L085_02740 (rplV)
  Archaea
    L085_02740 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF733
Motif
Other DBs
NCBI-ProteinID: AIA46006
Position
complement(594245..594577)
Genome map
AA seq 110 aa AA seqDB search
METIAKHRHARSSAQKVRLVADLIRGKKVSQALETLTYTNKKAAGLVKKVLESAIANAEH
NDGADIDDLKVTKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVVVSDR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaaactatcgctaaacatcgccacgctcgttcttctgctcagaaggttcgccttgtt
gctgacctgattcgcggtaagaaagtgtcgcaagctctggaaactctgacctacaccaac
aagaaagctgctggtctggttaagaaagtgctggagtctgccattgctaacgcagaacac
aacgatggcgctgacatcgatgatctgaaagttacgaaaatcttcgtagacgaaggccca
agcatgaagcgcattatgccgcgtgcaaaaggtcgtgcagatcgcatcctgaagcgcacc
agccacattactgtggttgtgtccgatcgctga

DBGET integrated database retrieval system