KEGG   Serratia sp. FS14: L085_03925Help
Entry
L085_03925        CDS       T03313                                 

Gene name
glpX
Definition
(GenBank) fructose 1,6-bisphosphatase II
  KO
K02446  fructose-1,6-bisphosphatase II [EC:3.1.3.11]
Organism
serf  Serratia sp. FS14
Pathway
serf00010  Glycolysis / Gluconeogenesis
serf00030  Pentose phosphate pathway
serf00051  Fructose and mannose metabolism
serf00680  Methane metabolism
serf01100  Metabolic pathways
serf01110  Biosynthesis of secondary metabolites
serf01120  Microbial metabolism in diverse environments
serf01130  Biosynthesis of antibiotics
serf01200  Carbon metabolism
Module
serf_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:serf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    L085_03925 (glpX)
   00030 Pentose phosphate pathway
    L085_03925 (glpX)
   00051 Fructose and mannose metabolism
    L085_03925 (glpX)
  09102 Energy metabolism
   00680 Methane metabolism
    L085_03925 (glpX)
Enzymes [BR:serf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     L085_03925 (glpX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_glpX
Motif
Other DBs
NCBI-ProteinID: AIA46241
Position
861247..862257
Genome map
AA seq 336 aa AA seqDB search
MKRELAIEFSRVTEAAALAGYKWLGRGDKNAADGAAVHAMRIMLNKVDIDGRIVIGEGEI
DEAPMLYIGEQVGTGQGDAVDIAVDPIEGTRMTAMGQSNALAVLAVGDRGTFLHAPDMYM
EKLVVGPAARGAIDLNRPLAENLQNVAERLGKPLSQLTVIVLAKPRHDGVIAQMQQLGVR
VFAIPDGDVAASILTCMPESEVDVMYGIGGAPEGVISAAVIRALDGDMQARLLPRHEVKG
DSAENRRIGEQELARCREMGIEAGQALRLDQMARNDNVIFSATGITKGDLLEGISRQGNM
ATTETLLIRGKSRTIRRIRSTHYLDRKDPALHEFLL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtgaattagccatcgaattctcccgcgttaccgaagccgccgcgctggcgggc
tacaaatggctgggacgcggcgacaagaacgccgccgacggcgcggcggtccacgccatg
cgcatcatgctcaacaaagtggatatcgatgggcgcatcgtgatcggcgaaggcgagatc
gacgaagcgccgatgttgtatatcggcgagcaggtcggtaccggtcagggcgacgcggtc
gacatcgcggtcgatccgatcgaaggcacccgcatgaccgccatgggccagtccaatgcg
ctggcggtattggcggtgggcgatcgcggcaccttcctgcacgcgccggacatgtacatg
gagaagctggtggtcggcccggcagcgcgcggcgccatcgatctcaaccggccattggcc
gagaacctgcagaacgtcgccgaacgactgggcaaaccgctgtcgcagctgacggtgatt
gtattggccaaaccgcgccacgacggcgtcatcgcgcagatgcagcaattgggcgtgcga
gtattcgccattcctgacggcgacgtagcggcctccattctcacctgcatgccggaaagc
gaggtcgatgtgatgtacggcatcggcggcgcgccggaaggggtgatctcagccgcggtg
atccgcgcgctggacggtgacatgcaggcgcgtttgctgccgcgtcatgaggtgaaaggc
gacagcgccgaaaaccgccgcatcggcgaacaggagttggcccgctgccgggagatgggt
atcgaagccggccaggcgctgcgtctggatcagatggcgcgcaacgacaacgtgatcttc
tccgccaccggcatcaccaagggcgatctgctggaaggcatcagccgccagggcaacatg
gccaccaccgaaacgttgctgatccgcggcaagtcgcgcaccatccgccgtattcgttcg
acccactatctggatcgcaaagacccggcgctgcacgagtttctgctgtaa

DBGET integrated database retrieval system