KEGG   Serratia sp. FS14: L085_04260Help
Entry
L085_04260        CDS       T03313                                 

Definition
(GenBank) alpha-D-glucose-1-phosphatase
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
serf  Serratia sp. FS14
Pathway
serf00010  Glycolysis / Gluconeogenesis
serf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:serf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    L085_04260
Enzymes [BR:serf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     L085_04260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase SHOCT Acid_PPase HAD Hydrolase_like Urocanase PNK3P Hydrolase_6 NT5C
Motif
Other DBs
NCBI-ProteinID: AIA46306
Position
complement(925240..925830)
Genome map
AA seq 196 aa AA seqDB search
MLYIFDLGNVIVDIDFKRVLGVWSNLSGTPLAVLSDRFAMGEVFQQHERGEISDEDFAGK
LCDEMGIALSFEQFATGWQAVFVALRPEVIDIMQRLRNEGHRVVVLSNTNRLHCNYWPQH
YPEVAAAADHLYLSQDLGMRKPEADIYQHVLAAENTAAADAVFFDDHPANVLAAQALGIK
TVHVTDRDVVPAYFAQ
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgctgtatatctttgatttaggtaatgtgatcgtcgatatcgatttcaagcgtgtgctg
ggcgtgtggagcaatttgagcggcacgccgttggcggtgctgtccgatcgtttcgccatg
ggtgaggtgttccagcaacatgagcgtggtgaaatcagcgatgaagacttcgccggcaag
ctgtgcgatgaaatgggcattgcgctcagcttcgaacaattcgccaccggctggcaggcg
gtatttgtcgcgctgcgcccggaagtgatcgacatcatgcagcgcctgcgcaacgaaggc
caccgggtggtggtgctgtcgaacaccaaccgtctgcactgcaactactggccgcagcac
tatcctgaagtggccgccgctgccgatcatctctatttgtcgcaagatctcggcatgcgc
aagccggaggccgatatctatcaacatgtgctggccgcggaaaacaccgccgccgccgac
gcggtgttcttcgacgatcacccggcgaacgtcctcgccgcgcaggcgctggggatcaag
acggtgcacgtcaccgatcgcgacgtggtgccggcctattttgctcaatga

DBGET integrated database retrieval system