KEGG   Serratia sp. FS14: L085_04745Help
Entry
L085_04745        CDS       T03313                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
serf  Serratia sp. FS14
Pathway
serf00051  Fructose and mannose metabolism
serf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:serf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    L085_04745
Enzymes [BR:serf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     L085_04745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh ApbA 3HCDH_N UDPG_MGDP_dh_N Sacchrp_dh_NADP ApbA_C
Motif
Other DBs
NCBI-ProteinID: AIA46403
Position
1035782..1036927
Genome map
AA seq 381 aa AA seqDB search
MKALHFGAGNIGRGFIGKLLADAGVELTFADVNQTVLDLLNSRKSYQVHVVGEQERVESV
NNVSAVNSGSEAAVALIAEADLVTTAVGPQILAKIAGTIAKGLVLRHQQGNVQPLNIIAC
ENMVRGTSQLKQHVFAALPQDEQAWVEQHVGFVDSAVDRIVPPADSNDPLEVTVETFSEW
IVDQTQFKGQPPAIAGMELTDNLMAFVERKLFTLNTGHAITAYLGQRAGLQTIRDAILDP
AIRRVVKGAMEESGAVLIKRYGFDADKHAAYINKILGRFENPYLHDDVERVGRQPLRKLS
AGDRLIKPLLGTLEYGLPHANLIQGIAAAMSYRSEQDPQALELAELLNTLGPKAALAQIS
GLPAESEVVEEAVAVYNAMHK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacattttggcgcagggaacatcggccgcggttttatcggcaagctgctg
gcggacgccggggttgagctgaccttcgccgacgtcaatcaaacggtgctggatctgctg
aacagccgtaaaagctaccaggtgcacgtggtgggcgagcaagagcgcgtagagagcgtc
aacaacgtcagcgccgtcaacagcggcagcgaagccgcggtggcgctgatcgccgaggcg
gatctggtgaccaccgccgttggcccgcaaattctcgccaaaatcgccggcacgatcgcc
aaagggctggtgctgcgccatcagcagggcaatgtgcagccgctgaacatcatcgcctgc
gagaacatggtgcgcggcaccagccagctgaagcagcacgtgtttgccgcgctgccgcag
gacgagcaggcatgggttgagcagcacgtcggcttcgtcgattcggcggtcgaccgcatt
gtgccgccggcggacagcaacgatccgctggaagtgacggtggaaaccttcagcgaatgg
atcgtcgatcagacgcagtttaaaggccagcctccggcgatcgccggcatggagctgacc
gataacctgatggccttcgtcgagcgcaagctgttcaccctcaacaccggccatgccatc
accgcctacctcggccaacgggccgggctgcaaaccattcgcgacgccattctcgacccg
gcgatccgccgcgtggtgaaaggggcgatggaagagagcggcgcggtgctgatcaagcgt
tacggcttcgacgccgacaagcacgccgcctacatcaacaaaattctcggccgcttcgaa
aacccgtatctgcacgatgacgtcgagcgcgtggggcgccagccgctgcgcaaactgagc
gccggcgatcgcctgatcaaaccgctgctgggcacgctggaatacggcctgccgcatgcc
aacctgatccagggcatcgccgccgccatgagttaccgcagcgaacaggatccgcaggcg
ctggagttggcggaattgctgaacacgctcgggccgaaagccgcgctggcgcaaatttcc
ggcctgccggcggaaagcgaggttgtagaagaggccgttgctgtgtataacgccatgcac
aagtag

DBGET integrated database retrieval system