KEGG   Serratia sp. FS14: L085_07190Help
Entry
L085_07190        CDS       T03313                                 

Definition
(GenBank) sucrose-6-phosphate hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
serf  Serratia sp. FS14
Pathway
serf00052  Galactose metabolism
serf00500  Starch and sucrose metabolism
serf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:serf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    L085_07190
   00500 Starch and sucrose metabolism
    L085_07190
Enzymes [BR:serf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     L085_07190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: AIA46889
Position
complement(1588347..1589756)
Genome map
AA seq 469 aa AA seqDB search
MEELSLIKQALRAVMNGQPLALRDPHRPDWHLAPSVGLLNDPNGFIQHNGVYHLFYQWNP
LGCDHRNKCWGHWQSADLLRWEHQPIALAPGACYDSHGCYSGSAVVAEGKITLIYTGNVK
FPDGSRTAYQCLAQESERGEYRKLGPVLPLPEGYSGHVRDPKVWRHQNDWYMVLGARDLQ
DRGKVLLFRSSDLRDWQALGEIAGSGLNGLEEFGYMWECPDLFSLDGDEVLICCPQGLTP
QPERYLNRYQAGYLLGKLDYRQAAFSHGEFRELDAGFEFYAPQTTLAEDGRRLLFGWMGV
PEQDEEAHPTRRYGWIHTMTCPRELSLRHGRLHQRPARELQQLRGERAGWQGRADNAPAY
ALGAAELQLTPQGPFNATFGEAMTLNWDGERLQLTRASLTNGRPEHRYWRGPVTHLQLLF
DRSSVEIFINHGEAVMSARYFPAGEPQLRLCGSAPLALEYWPLTPCMLE
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggaagaactcagcttaatcaaacaggcactgcgggcggtaatgaacggccagccgctc
gcgctgcgcgatccgcaccgaccggactggcatctggcacccagcgttggcctgctgaac
gatcccaacggctttatccagcacaacggcgtttatcatctgttttatcagtggaatccg
ctgggttgcgatcatcgcaacaaatgctggggacactggcagtcggctgatttgctgcgt
tgggagcaccagccaatcgccctggcgcccggcgcctgttacgacagccacggctgttac
tccggctcggcggtggtggcggaaggcaaaatcacgctgatctacaccggcaacgtgaaa
ttcccagacggctcacgcaccgcttaccaatgcctggctcaggaaagcgaacggggcgaa
tatcgcaaactcgggccggtgctgccgctgccggagggctacagcggtcacgtacgcgat
ccgaaagtgtggcgtcatcaaaatgactggtacatggtgctcggcgcgcgtgacttgcag
gatcgcggcaaggtgctgctgtttcgttccagcgatctgcgcgactggcaagcgctggga
gagatcgccggttccggactgaacggcttagaggaattcggctacatgtgggagtgcccg
gacctgttctcgttagacggcgacgaggtgttgatctgctgtccgcaggggctgacgccg
cagccggaacgctatctcaaccgttatcaggccggttatctgctcggcaagctggattac
cggcaggcggccttcagccacggcgaattccgcgagctggacgccggcttcgagttctac
gcgccgcagacgacgttggcggaagatggccgccgcctgctgttcggctggatgggcgtg
cccgagcaagatgaagaagcccatccgacgcgccgttacggctggatccacaccatgacc
tgcccgcgcgaactgtcgctgcggcatggccgcctccaccagcgcccggcgcgcgagctg
caacagctgcgcggtgagcgagcaggctggcaaggccgcgccgataacgcccccgcctat
gcgctgggggccgcggagctgcaattgacgccgcagggcccgttcaacgcaacctttggc
gaagcgatgacgctgaactgggacggcgaaaggctgcagctgacgcgcgcttccctgacc
aacggccggccggagcaccgttactggcgcggcccggtcacgcatctgcaactgctgttc
gatcgttccagcgtggagattttcatcaaccacggcgaggcggtgatgagcgcacgctac
ttccccgcgggtgagccgcaactgcggctgtgcgggagcgcgccgctggcgttggaatac
tggccgctgacgccatgcatgctagaatga

DBGET integrated database retrieval system