KEGG   Serratia sp. FS14: L085_07860Help
Entry
L085_07860        CDS       T03313                                 

Definition
(GenBank) glutathione synthetase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
serf  Serratia sp. FS14
Pathway
serf00270  Cysteine and methionine metabolism
serf00480  Glutathione metabolism
serf01100  Metabolic pathways
Module
serf_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:serf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    L085_07860
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    L085_07860
Enzymes [BR:serf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     L085_07860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATP-grasp_3 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AIA47019
Position
complement(1738473..1739423)
Genome map
AA seq 316 aa AA seqDB search
MIKLGIVMDPIDSINIKKDTSFAMLLEAQRRGYELHYMEMNDLYLHAGDGRARTRLLSVK
EDKESWFSFGAEQDLALHELDVILMRKDPPFDTEYIYATYILERAEVKGTLVVNKPQSLR
DCNEKLFTAWFPELTPDTLVSRSAAHIRKFHQQHGDIILKPLDGMGGASIFRVKQDDPNL
SVIIETLTEHGSRFCMAQNFLPAIKDGDKRILVVDGEPVPYCLARIPAQGETRGNLAAGG
RGEARPLSESDWKIARAVAPTLKEKGLIFVGLDVIGDRLTEINVTSPTCAREIEAAFPIS
ITGMLMDAIEKRLAAK
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgattaagctcggcatcgtgatggaccctatcgattccatcaacatcaagaaagacacc
agcttcgccatgctgctcgaagcgcagcgccgcggttacgaattgcactacatggagatg
aacgatctctatctgcatgccggtgacgggcgcgcccgcacccgcctgctgagcgtgaag
gaagataaggagagctggttcagcttcggcgccgagcaggatctggcgctgcacgagctg
gacgtgatcctgatgcgcaaggatccgccgttcgataccgaatacatctacgcgacctac
attctggaacgtgccgaagtcaaaggcacgctggtggtcaacaagccgcaaagcctgcgc
gactgcaacgagaagctgttcaccgcctggttcccggagctgacgccggatacgctggtc
agccgcagcgccgcgcacatccgcaaattccaccagcagcacggcgacatcatcctgaaa
ccgctggacggcatgggcggcgcgtctatcttccgcgtgaagcaggacgatcctaacctg
tcggtgatcatcgaaaccctgaccgaacacggcagccgtttctgcatggcacagaacttc
ctgccggcgatcaaggacggcgacaagcgcattctggtggtggacggcgagccggtgcct
tactgcctggcgcgcattccggcgcagggtgaaacccgcggcaacctggcggccggcggc
cgcggcgaagcgcgcccgctgagcgaaagcgactggaaaatcgcccgcgccgtcgccccg
acgctgaaagagaaagggctgatcttcgtcggcctggacgtgatcggcgatcgcctgact
gaaatcaacgtcaccagcccgacctgcgcgcgcgagatcgaggcggcattcccgatttcg
attaccggcatgctgatggacgccattgaaaagcgcctggcggcgaagtaa

DBGET integrated database retrieval system