KEGG   Spiroplasma eriocheiris: SERIO_v1c02910Help
Entry
SERIO_v1c02910    CDS       T03974                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
seri  Spiroplasma eriocheiris
Pathway
seri03010  Ribosome
Brite
KEGG Orthology (KO) [BR:seri00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SERIO_v1c02910 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:seri03011]
    SERIO_v1c02910 (rplV)
Ribosome [BR:seri03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    SERIO_v1c02910 (rplV)
  Bacteria
    SERIO_v1c02910 (rplV)
  Archaea
    SERIO_v1c02910 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 Mic1
Motif
Other DBs
NCBI-ProteinID: AKM53875
UniProt: A0A0H3XHP6
Position
307949..308287
Genome map
AA seq 112 aa AA seqDB search
MNVQAHLRMIRISPRKVSLVADLIRNKKVGEAIVILDNTNKKSSVPVKKLVKSAVANAVN
NNGLDADKLFIKEIFVNEGPTLKRFRPRAHGRAYEILKRTSHITITVSDGAQ
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtacaagcacacttaagaatgattagaatttcaccccgtaaagttagtttggtt
gccgatttaattcgtaataaaaaagttggagaagcaattgtcattctagataacacaaat
aaaaaatcatcggtgccagttaaaaaactggttaaatcagcggtggcaaatgctgttaat
aataacggcttagatgctgataaattatttattaaagaaatcttcgttaacgaaggacca
acattaaaacgtttccgcccccgtgcccacggaagagcatatgaaattttaaagagaact
agtcacatcacaattaccgttagtgatggagcacaataa

DBGET integrated database retrieval system