KEGG   Serinicoccus sp. JLT9: SGUI_1181Help
Entry
SGUI_1181         CDS       T04436                                 

Definition
(GenBank) putative low-affinity inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
serj  Serinicoccus sp. JLT9
Brite
KEGG Orthology (KO) [BR:serj00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    SGUI_1181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 GtrA
Motif
Other DBs
NCBI-ProteinID: ANS78577
UniProt: A0A1B1NAX1
Position
complement(1310475..1312046)
Genome map
AA seq 523 aa AA seqDB search
MTQVDFRPVEKATRSTRGEVGRIGVAILFIVGVIVFTGAAFGDVEQAYLLIAAAVIGGYM
ALNIGANDVANNVGPAVGSMAMTMATAIGIAAVFEAAGAIIAGGDVVETVKSGIIDPDSI
ADPQVFVWVMLGSLLGAALWLNIATFMGAPVSTTHAIVGGVLGGGVASSGWAVVNWDVMG
SIAMSWVISPLVGGLIAAGTLYLLKRTVLFHDRPVDSATRVVPLLIAVMAWAFATYLALK
GLSNLVSISFPVALLGGLVIAVITYAVVRPMVIRAAPGLTQDTEGVNSLFTIPLICAAAL
LSFAHGANDVANAVGPLAGIVEVLDGGAAGGEAGIPLWVLVIGALGISVGLALFGPKLIR
TVGSEITELDRSRAFCIALAAALTVIVASQLGLPVSSTHVALGGIFGVGFLREFLDDRMN
RAIEKVLRAHRDDTDFAKVEGMLEAFREARPEDKRRMLDTLQEMGPEAVITAAQGKKLRK
ALKRQLVRRSHILKIASAWVITVPVAGLLSALFFFALRGMLLP
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcaggtggacttccggcccgtggagaaggccaccaggagcacccgaggcgaggtg
gggcggatcggcgtcgccatcctcttcatcgtcggcgtcatcgtcttcaccggcgcggcc
ttcggggacgtggaacaggcatacctgctcatcgcggcggccgtcatcggcggctacatg
gccctcaacatcggggccaacgacgtcgccaacaacgtcggcccggcggtcggctcgatg
gcgatgaccatggccaccgcgatcggcatcgcggcggtcttcgaggcggccggagcgatc
atcgccggcggcgacgtggtcgaaaccgtgaagagcggcatcatcgacccggacagcatc
gccgacccgcaggtcttcgtctgggtgatgctgggctcgctgctgggggcggcgctgtgg
ctcaacatcgcgaccttcatgggtgcgccggtgtcgaccacccacgcgatcgtcggcggt
gtgctcggcggcggcgtcgcctcctccggctgggcggtcgtcaactgggacgtcatgggc
tccatcgcgatgagctgggtcatctcgccgctggtcggtggcctcatcgcggccgggacg
ctctacctcctcaagcgcaccgtgctcttccacgaccggccggtggactccgcgacccgg
gtggtgcccctgctcatcgccgtcatggcctgggcgttcgccacctacctcgccctcaag
gggctgtccaacctcgtcagcatctccttcccggtcgcgctgctcggcggcctcgtcatc
gccgtcatcacgtatgccgtcgtccgaccgatggtcatccgcgccgcgcccggtctcacc
caggacaccgagggggtcaacagcctcttcaccatcccgctcatctgcgccgcggcgctg
ctcagcttcgcccacggcgccaacgacgtcgccaacgcggtcggcccgctcgccggcatc
gtcgaggtgctcgacgggggagcggccgggggcgaggcggggatccccctctgggtgctc
gtcatcggcgccctgggcatctcggtcggcctggccctcttcgggccgaagctcatccgc
acggtcggcagcgagatcaccgagctggaccggtcccgggccttctgcatcgcgctggcg
gccgcgctcacggtgatcgtcgcgagccagctcgggctgccggtgagctcgacccacgtc
gcgctcggcgggatcttcggcgtcggcttcctccgggagttcctcgacgaccggatgaac
cgggcgatcgagaaggtgctccgggcccaccgcgacgacaccgacttcgccaaggtcgag
gggatgctcgaggccttccgggaggcgcggcccgaggacaagcggcggatgctggacacg
ctgcaggagatgggcccggaggccgtcatcaccgccgcgcagggcaagaagctgcgcaag
gcgctcaagcgccagctggtccgccgctcgcacatcctcaagatcgcctccgcctgggtc
atcaccgtcccggtggcggggttgctctccgccctgttcttcttcgcgctgcgcgggatg
ctgctcccctga

DBGET integrated database retrieval system