KEGG   Serratia sp. MYb239: CLM71_00170Help
Entry
CLM71_00170       CDS       T05477                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
serm  Serratia sp. MYb239
Pathway
serm00051  Fructose and mannose metabolism
serm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:serm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CLM71_00170
Enzymes [BR:serm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     CLM71_00170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh F420_oxidored Sacchrp_dh_NADP ApbA
Motif
Other DBs
NCBI-ProteinID: AVJ15683
UniProt: A0A2R3GVJ4
Position
41067..42221
Genome map
AA seq 384 aa AA seqDB search
MKALHFGAGNIGRGFIGKLLADAHAELTFADVNQTVLDALNQRHSYPVRVVGEQERTKTV
NNVNAVNSGSDDAVALIADADIVTTAVGPQILAKIAATIAKGLSERRRQGNQQPLNIIAC
ENMVRGTSSQLKQHVFAELSAEEQAWAEQHVGFVDSAVDRIVPPAEVGSDDPLAVTVETF
SEWIVDQTQFKGAPPAIAGMELTDNLMAFVERKLFTLNTGHAITAYLGQQAGLQTIRDAI
LDPAVRLVVKGAMVESGAVLIKRYGFEPAKHAAYIEKILSRFENPYLHDDVERVGRQPLR
KLSAGDRLIKPLLGTLEYGLPHANLIRGVAAAMHYRSAQDPQAQELAQLLSERGPKAALA
QISGLPEDGEVVEQAVAVYNAMQK
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacattttggcgccggtaatatcggccgcggctttattggcaaactgctg
gccgatgcgcatgccgaactgactttcgccgacgttaaccagacggtgctggacgcgctc
aatcaacgccatagctacccggtgcgcgtcgtcggcgagcaggaacgcacgaaaacggtg
aataacgtcaacgcggtcaacagcggcagcgatgacgccgtggcgctgatcgccgacgcc
gatatcgtcaccaccgccgtcggcccgcagatcctggccaaaattgccgctacgatcgcc
aaagggctgagcgaacgccgccgccagggcaatcaacagccgctgaatattatcgcctgc
gagaacatggtgcgcggcaccagcagccagctgaaacagcacgtcttcgccgaactgtcg
gcggaagagcaggcgtgggcggagcagcatgtcggcttcgtcgattccgctgtggatcgc
atcgtgccgccggcggaagtgggcagcgacgatccgctggcggtaacggtggagaccttc
agcgaatggatcgtcgaccagacccagttcaagggcgcgccgccggcgattgccggtatg
gagctgaccgataacctgatggcgtttgtcgaacgtaaactgttcacgctcaataccggc
cacgcgattaccgcctatctgggccagcaggccgggctgcagaccatccgcgacgcaatt
ctcgacccggcggtgcgcctggtggtgaagggcgcgatggtggagagcggcgcggtgctg
atcaagcgctacggctttgagccggcaaaacacgcggcctatatcgagaaaatcctcagc
cggtttgaaaacccctacctgcacgacgacgtcgagcgcgtgggccgtcagccgctgcgt
aaactgagcgccggcgaccgtctgatcaagccgctgctgggcacgctggagtatggcctg
ccgcacgccaacctgattcggggcgttgccgccgccatgcattaccgcagcgcgcaggat
ccgcaggcgcaggaactggctcagctgctgagcgaacgcgggccgaaagccgcgctggcg
caaatttccggtctgccggaagacggcgaggttgtggaacaggccgtagctgtgtataac
gccatgcaaaagtag

DBGET integrated database retrieval system