KEGG   Serratia sp. MYb239: CLM71_04755Help
Entry
CLM71_04755       CDS       T05477                                 

Gene name
ggt
Definition
(GenBank) gamma-glutamyltransferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
serm  Serratia sp. MYb239
Pathway
serm00430  Taurine and hypotaurine metabolism
serm00460  Cyanoamino acid metabolism
serm00480  Glutathione metabolism
serm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:serm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    CLM71_04755 (ggt)
   00460 Cyanoamino acid metabolism
    CLM71_04755 (ggt)
   00480 Glutathione metabolism
    CLM71_04755 (ggt)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:serm01002]
    CLM71_04755 (ggt)
Enzymes [BR:serm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     CLM71_04755 (ggt)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     CLM71_04755 (ggt)
Peptidases and inhibitors [BR:serm01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   CLM71_04755 (ggt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept Sporozoite_P67
Motif
Other DBs
NCBI-ProteinID: AVJ16491
UniProt: A0A2R3GYB6
Position
complement(1015857..1017620)
Genome map
AA seq 587 aa AA seqDB search
MFLHKWSKPLTMAALLVSGSLHAASTPAVEARQGMVVTSQRLASQVGVDILKMGGNAVDA
AVAVGYAQAVVNPCCGNIGGGGFMTVHLADGTDTFINFRETAPAAASANMYLDADGKVKK
GASLYGYLAAGVPGTVLGMETARKKYGKLSREQVMAPAIKLAREGFVLTRADTDILDTTV
ARFKQDPEAAKIFLRKDGSALQPGDRLVQADLANTLEAIAKQGPDAFYHGKIPQAVEAAA
RKGGGILTAADFANYKVTETAPITCSYRGYKFVSSPPPSSGGVTLCETLNILEGYDLKSM
GFNSAAAIHTMTEAMRHAYMDRNTYLGDPAFINNPIDRLVSKSYAEQIRKQIVPGKATPS
ENVQPGMEPHEKPETTHYSIVDHDGNAVSTTYTVNGRFGAVVIAPGTGFFLNDEMDDFTV
KVGEKNLYGLVQGTANAIAPGKRPLSSMSPTLVTKDNKIFMVLGSPGGSRIITITLQTAL
NVIDHGMAPQEAVDAPRIHHQWLPDEVYYEQRGVSADTLNLLQKMGYKMVEQTPWGAAEL
ILVGLPGAAGVTPPNSGNDSAVSGKVREGYLYGANDVRRPAGAAIGY
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgtttttgcataaatggagtaaacccctgaccatggcggcgctgctggtcagcggcagc
ctgcacgccgcctccacgccggcggtagaagcacggcagggtatggtggtcacctcgcaa
cgtctggcctcacaggtgggcgtcgacattctgaaaatgggcggtaatgcggtggatgcc
gccgtggccgtcggctacgcgcaggcggtggttaacccctgctgcggcaatatcggcggc
ggtggttttatgaccgtccatctggccgacggcaccgatacctttatcaacttccgtgaa
accgcgccggcggcggccagcgccaatatgtacctggacgccgacggcaaagtgaaaaaa
ggcgccagcctgtacggctacctggccgccggcgtaccgggcaccgtgctgggcatggaa
accgcgcgcaaaaaatacggcaagctgagccgcgaacaggtgatggcgccggccatcaag
ctggcgcgggaaggctttgtgctgacgcgcgccgataccgatatcctcgataccaccgtc
gctcgctttaagcaggaccccgaagcggccaaaatcttcctgcgtaaagacggcagcgcg
ctgcagccgggcgatcgtctggtgcaggccgatctggccaatacgctggaagccatcgcc
aaacaggggccggacgccttctatcacggtaaaattccgcaggcagtggaagcggcggcc
cgcaagggcggcggtattctgaccgcggccgacttcgccaactacaaagtcaccgaaacg
gcgccgattacctgcagctaccgcggctataagttcgtctcatcgccgccgccaagctcc
ggcggcgttacgctgtgcgaaacgctgaatatcctggaaggctacgatctgaaaagtatg
ggctttaactcggcggcggccatccacaccatgaccgaagccatgcgccacgcctatatg
gatcgcaacacctatctcggcgacccggcctttatcaacaacccgatcgaccggctggtc
agcaaaagctatgccgagcaaatccgcaagcaaatcgtccccggcaaggcaacgccgtcg
gaaaacgtgcagcccggcatggagccgcatgaaaagccggaaaccactcactactccatc
gtcgatcatgacggcaatgcggtatcaaccacctatacggtcaacggccgcttcggcgcg
gtggtgatcgcccccggcaccggtttcttcctcaatgacgaaatggatgactttaccgtg
aaggtcggcgagaaaaacctctatgggctggtgcagggcaccgccaatgccatcgccccc
ggtaagcgcccactatcgtcgatgagcccgacgctggtgaccaaagacaataaaatcttt
atggtgctcggctcaccgggcggttcgcgcattatcaccatcacgctgcagaccgcgctt
aacgtgatcgaccacggtatggcgccgcaggaggcggtggatgcgccgcgcattcaccac
cagtggctgcctgacgaggtctactacgaacagcgcggcgtctccgcggatacgctgaat
ctgctgcagaagatgggttacaaaatggtggagcagacgccatggggggcggccgaactg
attctggtcggtctgccgggcgcggcgggcgtgacgccgcccaactccggcaatgattcg
gcggtctcaggcaaggtgcgcgaaggctatctgtacggcgctaacgacgtacgccgcccg
gccggcgcggcgatcggctactga

DBGET integrated database retrieval system