KEGG   Serratia sp. MYb239: CLM71_07175Help
Entry
CLM71_07175       CDS       T05477                                 

Definition
(GenBank) L-2-hydroxyglutarate oxidase
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
serm  Serratia sp. MYb239
Pathway
serm00310  Lysine degradation
serm01100  Metabolic pathways
serm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:serm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    CLM71_07175
Enzymes [BR:serm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     CLM71_07175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_3 Pyr_redox_3 NAD_binding_8 FAD_binding_2 Mqo Pyr_redox Lycopene_cycl Amino_oxidase Pyr_redox_2 Thi4 Sacchrp_dh_NADP TrkA_N K_oxygenase NAD_binding_9 PALP
Motif
Other DBs
NCBI-ProteinID: AVJ16925
UniProt: A0A2R3GZ35
Position
1502037..1503227
Genome map
AA seq 396 aa AA seqDB search
MYDVIIIGSGLVGLGVAHALQEHNPHLKLLIVDKESGPAAHQSGHNSNVVHSGIYYKPGS
LKARLARQGNQSMFAFCRQHELYHDRCGKVIVATQLKELELLENIYRRGLENGLAVHRLS
AAELREREPHVNGLEALLVPDAGIVNYAQVAAKLADIIRQRGGEIHFDRQVVGIAERSDG
VEVQTPGQSYQGKWLVNCAGLFSDRIAKLAGYDTGMKIVPFRGEYFVLNSEKNYLVNHLI
YPVPNPDFPFLGVHFTRMHNGKRDVGPNAVLAFKREGYRKCDVSLRDLGEVLSYRGFWKI
AGQYMGEGLAEVRRSLSRRRFTENARQLIPALQEQDIQPGPAGVRAQALTADGKLVDDFH
FVTGRRSLHVCNAPSPAATASLEIGREIVRQHLAHL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtatgacgtaatcattatcggcagcgggctggtggggctgggcgtcgcccatgcgttg
caggaacacaatccgcacctgaaattgctgattgtggataaagagtccggcccggcggcc
caccagagcggccataacagcaatgtggtgcactccggcatctactataagcccggcagc
ctgaaggcgcgcctagccaggcagggcaaccagagcatgtttgccttctgccgtcagcat
gagctgtatcatgaccgctgcggcaaggtgattgtcgccacacagttgaaggagctggag
ttgctggagaatatctaccggcgtggtctggagaacggcctggcggtgcaccgcctgtcg
gccgccgaactgcgcgagcgggaacctcatgtcaacgggctggaggcgctgctggtgccc
gacgccggcatcgtcaactatgcgcaggtggccgccaaactggcggacatcatccggcag
cgcggcggtgagattcactttgaccggcaggtggtggggatcgcagagcgcagcgacggc
gtcgaggtacagacgccggggcagagctatcagggaaaatggctggtcaactgcgcgggg
ctgttcagcgaccgcattgccaaactggcgggctatgacaccggcatgaaaattgtgccg
tttcgcggtgaatactttgtgctgaacagtgaaaaaaattatctggtcaatcacttgatt
tatccggtgccgaacccggactttcccttcctcggcgtacatttcacccgtatgcacaac
ggcaaacgggacgtggggccgaacgcggtgctggcattcaagcgcgagggttaccgcaaa
tgtgacgtcagcctgcgcgatctgggcgaagtgctgagctatcgcggcttttggaagatt
gccggccagtatatgggggaagggctggcggaggtgcggcgctcgctgtcgcgccgccgg
tttacggaaaatgcccgccagctgattccggcgctgcaagagcaagatattcaacccggc
cccgccggcgtccgggcgcaggcgctgaccgctgacggcaagctggtggacgacttccac
ttcgtgaccggccgccgttcgctgcacgtgtgcaatgcgccttccccggcggcgaccgct
tcgctggagattggccgcgaaatcgtacgtcagcatcttgctcacctgtaa

DBGET integrated database retrieval system