KEGG   Serratia sp. MYb239: CLM71_10275Help
Entry
CLM71_10275       CDS       T05477                                 

Definition
(GenBank) esterase
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
serm  Serratia sp. MYb239
Pathway
serm00903  Limonene and pinene degradation
serm00930  Caprolactam degradation
serm01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:serm00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CLM71_10275
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    CLM71_10275
Enzymes [BR:serm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     CLM71_10275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 Peptidase_S9 COesterase Abhydrolase_6 Hydrolase_4
Motif
Other DBs
NCBI-ProteinID: AVJ17498
UniProt: A0A2R3H0N1
Position
complement(2150680..2151609)
Genome map
AA seq 309 aa AA seqDB search
MMNQQTKQAVKEWSDSLAGLGPILTGQDTVTPMSEVRNAYTRMLAKNPAPAGVSFNEVDM
GGVPGTLVTPDILETDAIVMYIHGGAYIVGEPAGYHGIGGNYANMLGARVYMPDYRLAPE
YPFPTPVTDTVRAYEWLIEQGFDASKIVLAGESAGGAMVVTVMVAARNKGLPLPAAGVSI
SPWANLEHTGVSMTNREGLDPLNTKAGLDFLARTFLGDALPNHPMASPVFADVTGLPPVL
IQIGENELMLSDAMRLATHLGDNRVRVNLEVWPGMFHAWHFFSTLQPEAVQALESSVAFI
KQALQDASK
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatcaacaaaccaaacaagctgtaaaagaatggtcagacagtctggccggtctg
gggccaatccttacaggtcaggataccgtaacgccgatgagtgaggtccgtaacgcctac
acccgtatgctggctaaaaatcctgcacctgccggagtgagctttaatgaggttgatatg
gggggcgtaccaggcactttggttacgcccgacatccttgaaaccgatgctatcgttatg
tacatccacggcggggcctatattgtcggtgaaccagctggctatcacggtattggcggc
aactacgccaatatgctgggcgcaagggtctacatgccggactaccgactggctccggag
tatcctttccctacgccagttaccgatacggttcgtgcctatgagtggttgattgaacaa
ggctttgatgccagtaaaatcgtgctggcaggcgagtctgcgggtggagcgatggttgtt
accgtcatggttgccgcacgtaacaagggtctcccgcttccggccgctggtgtctctatc
tcaccatgggccaatcttgaacatacgggtgtatccatgaccaatagggaaggtctcgat
cccttaaacacaaaagcaggtttggattttctggcgcgcaccttcctgggtgatgcgttg
cctaaccatccaatggcatcaccggtatttgccgatgtgacgggtctaccgccagtgctc
attcaaattggcgaaaacgaacttatgctgagcgacgcgatgcgtctggcaacgcatctg
ggtgataaccgcgttcgtgtaaatctggaagtctggccgggtatgttccacgcttggcat
ttcttctcaacgctgcagccagaagcggtacaggctctcgaaagttcagtcgcctttatt
aagcaagccctgcaggatgcatccaagtaa

DBGET integrated database retrieval system