KEGG   Serratia sp. MYb239: CLM71_19075Help
Entry
CLM71_19075       CDS       T05477                                 

Definition
(GenBank) amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
serm  Serratia sp. MYb239
Pathway
serm00970  Aminoacyl-tRNA biosynthesis
serm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:serm00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CLM71_19075
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:serm03029]
    CLM71_19075
Enzymes [BR:serm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CLM71_19075
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CLM71_19075
Mitochondrial biogenesis [BR:serm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CLM71_19075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase NAD2
Motif
Other DBs
NCBI-ProteinID: AVJ19080
UniProt: A0A2R3H5C8
Position
complement(3999174..4000523)
Genome map
AA seq 449 aa AA seqDB search
MENWTLRQAAAALASGDITSERLTADALARIDDPQGEGARAFIRVYHDWARRQAQDADRR
RAAGQPLSALDGVPVSVKDLFDVAGEATTGGSRTLMQAPAAQRHAAVVARLLQGGAVVIG
KTNMTEFAYSGLGINPHYGTPANPWRREERRIPGGSSSGAAVAVSDGMGFGAIGSDTGGS
VRIPAAFCGLTGYKPSASRIDMTGVQPLSPSLDSVGVIAHGLADCIALDGLIARQPLLPT
AQPLAQARFALPQTLALDELDETVSAAFQRALRRLAQAGARIDALPCDEFAELAAINAAG
GFTALESWQWHQTLIAEQAAAYDPRVLSRIRRGAALGEQDGRRLREQRLDWQRRVAGSLQ
GYHALLMPSVPFVAPTIAELEADEAHYFRINGAALRNPSIINFLDGCAVSLPIQAPGEAP
VGLMVAGLAQQDEALLGWALSVERCLAGA
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atggaaaactggacattacgacaggccgccgccgcactcgccagcggcgatatcacttct
gaacggctgaccgccgacgcgctggcgcgaattgacgacccgcagggggaaggggcgcga
gcgtttatccgcgtgtatcacgactgggcgcggcgacaggcgcaggacgccgaccgccgg
cgtgcggccgggcagcctctctctgcgctggacggcgtgccggtgtcggttaaagacctg
tttgacgtggcgggcgaggccactaccggcggctcacggacgctgatgcaggcgccggcg
gcgcagcgtcatgcggcggtggtggcgcggctgctgcagggcggcgcggtggtgatcggc
aaaaccaatatgactgaattcgcctactccggcctgggcattaacccgcattacggcacg
ccggccaatccgtggcggcgggaggagcggcgaattcccggcggttcctcgtccggcgcc
gcggtggcggtcagcgacggcatgggctttggcgcgattggcagcgataccggcggctcg
gtgcgcattccggcggcgttctgcggcctgaccggctataagcccagcgccagccgcatc
gacatgacgggcgtgcagccgctgtcgccgtcgctggactccgtcggcgtgattgcccac
ggtctggcggactgcatcgcgctggatgggctgattgcgcggcagccgttgctgccgacc
gcccagccgttggcgcaggcgcgctttgcgctgccgcagacgctggcgctggatgaactg
gacgagacggtgtccgcggcgtttcagcgtgcgctgcggcggctggcgcaggcgggcgcg
cggattgacgccctgccttgcgatgagtttgccgaactggcggcgatcaacgcggccggc
ggctttaccgcgctggagtcctggcagtggcaccagacgctgattgccgagcaggcggcg
gcttacgacccgcgggtgctgtcgcgcatccgacgtggtgcggcgctgggcgagcaggac
ggccgccggctgcgggagcagcggctcgactggcagcggcgggtggccggttcgctgcag
ggctaccacgcgttgctgatgcccagcgtgccgtttgtcgcgccgaccatcgccgagctg
gaggccgatgaggcgcactacttccggatcaacggcgccgcgctgcgtaacccttcaatc
attaatttcctggacggctgcgcggtgtcgttgccgattcaagcgccgggcgaagcgccg
gtagggctgatggtcgccggtctggcgcagcaggatgaggcgctattgggctgggcgctg
tccgttgagcgctgtctggccggcgcgtaa

DBGET integrated database retrieval system