KEGG   Serratia sp. ATCC 39006: CWC46_01410Help
Entry
CWC46_01410       CDS       T05968                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
serq  Serratia sp. ATCC 39006
Pathway
serq00051  Fructose and mannose metabolism
serq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:serq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CWC46_01410
Enzymes [BR:serq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     CWC46_01410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh ApbA_C UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AUH02366
UniProt: A0A2I5TCT6
Position
complement(302329..303477)
Genome map
AA seq 382 aa AA seqDB search
MKALHFGAGNIGRGFIGKLLADAGITLIFADVNQPLLDAINQRKSYQVHIVGEQMQVDTV
NNVSAVHSGSQQAIDLIADVDMVTTAVGPQILEKIAGTIAQGLVKRHDNGNQQALNIIAC
ENMVRGTSQLKQQVLKHLPESSLAWVSEHVGFVDSAVDRIVPPSETGSEDPLAVTVETFS
EWIVDETQFNGQPPAITGMELTNNLMAFVERKLFTLNTGHAITAYLGQRTGHKTIRDAIL
DPEIRRVVQGAMEESGAVLINRYGFDADKHQAYIQKILSRFENPYLHDDVERVGRQPLRK
LSAGDRLIKPLLGTLEYGLPHDNLVIGIAAAMHYRSEQDPQANELADLLQKLGPQAALAQ
ISGLDADSKVVGQAVSVYNAMQ
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacattttggcgccggtaatatcggccgcggatttattggtaagctgctg
gccgatgccggtatcaccctgatatttgctgatgtgaaccagccgttgctggatgccatc
aatcagcgaaaaagctaccaagttcatatcgttggcgaacaaatgcaggtggacaccgtt
aataatgtcagtgcggtgcacagtggtagccagcaagccatcgatctgattgccgacgtt
gatatggtgacgacggcggttggcccgcaaattctggagaaaattgctggcaccattgct
cagggcctggtaaagcgccatgacaacggcaaccagcaagcgctgaacatcattgcctgt
gaaaatatggtgcgtggcaccagccagttaaaacaacaggtgctaaagcatctgccggaa
tcgtctttggcatgggtgtcagaacatgttggttttgttgattccgccgtggaccggatt
gtgccaccgtcagaaaccggtagcgaagacccgctggctgtgacggtggaaactttcagt
gaatggattgtggatgaaacgcagtttaacggtcagcccccggccattaccggtatggaa
ctgaccaataatctgatggcgtttgtggagcgcaagctgtttacgctgaataccggtcat
gccattactgcatatctggggcagcgaaccggacataaaactatccgtgatgctattctc
gacccagaaatccgccgtgtagtgcaaggcgcaatggaagagagtggtgcggtgctgatc
aaccgttatggttttgatgccgataaacatcaggcttacatccagaaaatccttagccgt
tttgaaaacccgtatctgcatgatgatgtggagcgtgtcggacgccagccattacgtaag
ctgagcgcgggtgatcgtctaatcaaaccgttgttgggaacactggaatatgggttgccg
cacgataatctggtcatcggtattgcggcagcgatgcactaccgcagcgaacaggatcca
caagcaaatgaactggcggatttgctgcagaaattgggaccacaggccgcattggcacaa
atttccggtctggatgctgacagtaaggttgtcggacaggcagtgagtgtgtataacgcc
atgcagtga

DBGET integrated database retrieval system