KEGG   Serratia sp. ATCC 39006: CWC46_03970
Entry
CWC46_03970       CDS       T05968                                 

Definition
(GenBank) hypothetical protein
  KO
K19974  2-epi-5-epi-valiolone 7-phosphate 2-epimerase [EC:5.1.3.35]
Organism
serq  Serratia sp. ATCC 39006
Pathway
serq00525  Acarbose and validamycin biosynthesis
serq01100  Metabolic pathways
serq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:serq00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00525 Acarbose and validamycin biosynthesis
    CWC46_03970
Enzymes [BR:serq01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.35  2-epi-5-epi-valiolone 7-phosphate 2-epimerase
     CWC46_03970
SSDB
Motif
Pfam: AP_endonuc_2 Adenyl_transf
Other DBs
NCBI-ProteinID: AUG99047
UniProt: A0A2I5T396
Position
860765..861541
AA seq 258 aa
MNDIGLVSWRLPGDLLNALTLCNKLSTDVLEIDFGGPGRGLELDSLDLFKIREYAEVSNV
TVSSLAINTYNDIGIKSSSYECKTLFFRALDVAEQLGIHSLFIPSFRKSLIENEIDIINT
AGFLQWCCDAAGPQFVIASENTLIVDDSKLLLSLVNRKNFSLLFDPANLFLMGIDPYVYF
VELFPALYNDIHIKSPTGVSFSELDNDFLYYIHKLFRTPHILRKRFYYFSENDYRQAGNV
AIQNDISWLKEHLQLIKV
NT seq 777 nt   +upstreamnt  +downstreamnt
gtgaatgatatcgggctagtgagttggcgtttacccggtgacttactcaatgcactgaca
ctgtgtaataagttatcaacagatgtgctggaaattgatttcggtggcccaggtcggggg
ctggaactggatagcctggatttattcaaaatcagggaatatgctgaggtttccaatgtt
acagtcagttcactggcaattaatacctataacgacataggaataaagtcatcttcatat
gagtgtaagacgcttttttttcgagcattggatgtggctgaacagttaggcattcattct
ctgtttatcccttcttttagaaaaagtctgatagaaaacgaaatcgatataataaatact
gctgggtttttacaatggtgctgtgatgcagctgggccccagtttgttattgcgtcagaa
aatacgttgatagttgatgattcgaaactgttgttgtcgctggtgaatcggaagaatttt
tcattactttttgatcctgcaaatctttttctgatggggattgatccctatgtctatttt
gtcgagttgttcccggcattatataacgatatacatattaaatctcccaccggagtctcc
ttttccgagctggataacgattttctttactatattcataaattatttcggacccctcat
attctgcgaaagcgattttattatttttccgagaatgactatcggcaggcaggtaatgta
gctattcagaacgatatttcctggttaaaagaacatttacaattgataaaggtataa

DBGET integrated database retrieval system