KEGG   Serratia sp. ATCC 39006: CWC46_08420Help
Entry
CWC46_08420       CDS       T05968                                 

Definition
(GenBank) 23S rRNA pseudouridine(1911/1915/1917) synthase RluD
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
serq  Serratia sp. ATCC 39006
Brite
KEGG Orthology (KO) [BR:serq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:serq03009]
    CWC46_08420
Enzymes [BR:serq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     CWC46_08420
Ribosome biogenesis [BR:serq03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    CWC46_08420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 TruB_N S4_2
Motif
Other DBs
NCBI-ProteinID: AUG99837
UniProt: A0A2I5T5J8
Position
1817558..1818535
Genome map
AA seq 325 aa AA seqDB search
MAQQVQLTAIVAESQLGQRLDQALAELFPDYSRSRIKEWILEQRVQINGNIMNKPKEKVL
GGELVAIDALIEEDARWEAQAIALDIVYEDQDILVINKPRDLVVHPGAGNPDGTVLNALL
HHYPEIVDVPRAGIVHRLDKDTTGLMVVAKTVPAQTRLVESLQAREITREYEAVAVGTMT
AGGSVDEPIARHATKRTHMAVHPMGKPAVTHYRIMEHFRAHTRLRLRLETGRTHQIRVHM
AHINHPLVGDPLYGGRPRSPKGASDEFIAVLRGFDRQALHATMLRLYHPISGIQMEWHAP
LPQDMVKLIDALKADTEAFKEQLGW
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggcacaacaagtacaactcacggcaatagtggccgaatctcaactcggacaacgttta
gatcaggctttagccgaattgttccctgattattcccgttcacgcataaaagagtggatt
ttggaacagcgggtacagattaacggcaatattatgaataagccaaaagagaaggtgctt
ggtggcgaattagtggccattgatgcattgatcgaagaggatgcgcgttgggaagcacaa
gcaattgcactggatattgtttatgaagaccaggatattctggtgatcaataaaccccga
gatctggttgtacatcctggcgcgggaaatcctgacggtacggtattaaatgcattgctc
catcattatccagaaattgtggatgttcctcgtgctgggattgttcatcgactggataaa
gataccactggattgatggttgtggcgaagaccgtaccggcccaaacccggctggtggag
tcgttgcaggcccgtgaaattacccgtgaatatgaagcggtggcggttggtacgatgacg
gcgggagggtcggttgatgagccgatagcccgtcatgctacaaaacgtactcacatggct
gttcatccgatgggaaaacctgctgttacgcattaccggattatggaacatttccgcgct
catacccgtttgcggttacgtttggaaaccggccgtactcatcagattcgcgtacatatg
gcacatataaatcatcctttggtgggtgatcctttatatggtgggcgtccacgctctccg
aaaggagcgtcagacgaatttatcgcggttctacgtggttttgatcgccaggctctacat
gccaccatgttgcgtttgtatcaccctatcagtggaattcagatggagtggcatgctccc
ctgccacaggatatggtgaaattgatagacgcattaaaagctgacacagaagcgtttaaa
gaacaactgggctggtga

DBGET integrated database retrieval system