KEGG   Serratia sp. ATCC 39006: CWC46_15360Help
Entry
CWC46_15360       CDS       T05968                                 

Definition
(GenBank) trans-aconitate 2-methyltransferase
  KO
K00598  trans-aconitate 2-methyltransferase [EC:2.1.1.144]
Organism
serq  Serratia sp. ATCC 39006
Brite
KEGG Orthology (KO) [BR:serq00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CWC46_15360
Enzymes [BR:serq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.144  trans-aconitate 2-methyltransferase
     CWC46_15360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_31 Methyltransf_25 Methyltransf_23 Methyltransf_11 Methyltransf_12 MTS PCMT Methyltransf_32 NodS Methyltransf_2 FtsJ Ubie_methyltran
Motif
Other DBs
NCBI-ProteinID: AUH01071
UniProt: A0A2I5TLG6
Position
complement(3360811..3361581)
Genome map
AA seq 256 aa AA seqDB search
MSWSPKQYTVFEDQRTRPVRDLLNAVSTTDVMAAIDLGCGPGNSTGILVDRFPNASVSGI
DSSADMIESARKRLPKCQFTVTSIEAWDGPGSFDVILANAALHWVPNHASLLPRLIKFLS
SRGSLAIQMPDNLNEPAHRLMREIAVEQPWADKLAKSAGERTIVESADWYYSLLRPLCSR
VDIWRTTYHHPLAGGANAVVEWFKGSGLRPFLLPLNDVEQERYLSQYRAAVSDAYPTLSD
GTVLLPFPRLFIVASR
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgagctggtcacccaaacaatacactgtattcgaggatcaacgcacccgtccagtacgc
gatttactcaatgcggtatctactaccgatgttatggcggcaatcgatctcggttgcggc
cccggcaattcaactgggattcttgtagacagatttccaaatgcatcggtcagcggaata
gatagctccgcagatatgatcgaatctgccagaaagcgtctcccgaaatgccaattcacg
gtcacgtctatcgaggcctgggatgggcccggttcatttgacgtcattctcgcaaatgcg
gctctccattgggtgcccaaccacgcatctctattaccgcgattgatcaaatttcttagc
agtcgaggaagtttggccatacagatgccggacaacctcaacgaacccgcgcaccggctt
atgcgtgaaatagccgtcgaacagccatgggccgacaaactcgccaagtctgcgggtgag
cgtacgatagtggaaagtgcagattggtattatagcctcttgcggccgctctgcagcaga
gtggacatatggcgaaccacttatcaccacccactcgcaggaggcgcgaacgctgtggtg
gagtggttcaaaggcagcggccttcgtcccttcctcttaccactcaacgatgttgaacaa
gagagatatctttctcaatatcgtgcagccgtttctgatgcatatccgacattgtctgat
ggtactgtgctgctgcccttcccacgattgttcatcgtggcgtctcgctga

DBGET integrated database retrieval system