KEGG   Serratia sp. SCBI: SERRSCBI_00345Help
Entry
SERRSCBI_00345    CDS       T03314                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
sers  Serratia sp. SCBI
Pathway
sers00051  Fructose and mannose metabolism
sers01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sers00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SERRSCBI_00345
Enzymes [BR:sers01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     SERRSCBI_00345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh 3HCDH_N ApbA UDPG_MGDP_dh_N Sacchrp_dh_NADP ApbA_C
Motif
Other DBs
NCBI-ProteinID: AIM19708
Position
71422..72567
Genome map
AA seq 381 aa AA seqDB search
MKALHFGAGNIGRGFIGKLLADAGVEVTFADVNQTVLDLLNSRKSYSVHVVGEQERVERV
NNVSAVNSGSEAAVALIAKADLVTTAVGPQILAKIAGTIAKGLVLRHQQGNVQPLNIIAC
ENMVRGTSQLKQHVFAALPQDEQAWVEQHVGFVDSAVDRIVPPADSSDPLEVTVETFSEW
IVDQTQFKGQPPAIAGMELTDNLMAFVERKLFTLNTGHAITAYLGQRAGLQTIRDAILDP
AIRRVVKGAMEESGAVLIKRYGFDADKHAAYINKILGRFENPYLHDDVERVGRQPLRKLS
AGDRLIKPLLGTLEYGLPHANLIQGIAAAMSYRSEQDPQAQELAELLNTLGPKAALAQIS
GLPAESEVVEEAVAVYNAMHK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacattttggcgcagggaatatcggccgtggttttatcggcaagctgctg
gcggacgcgggggttgaggtgaccttcgccgacgtcaatcaaacggtgctggatctgctg
aacagccgaaaaagctactcggtgcacgtggtgggcgagcaagagcgcgtggagcgcgtc
aacaacgtcagcgccgtcaacagcggcagcgaggcggcggtggcgctgatcgccaaggcg
gatctggtgaccaccgccgttggcccgcaaattctcgccaaaatcgccggcacgatcgcc
aaagggctggtgctgcgccatcagcagggcaatgtgcagccgctgaacatcattgcctgc
gagaacatggtgcgcggcaccagccagctgaagcagcacgtgttcgccgcgctgccgcag
gacgagcaggcatgggttgaacagcacgtcggctttgtcgattcggcggtcgaccgcatc
gtgccgccggcggacagcagcgatccgctggaagtgacggtggaaaccttcagcgaatgg
atcgtcgatcagacgcagtttaaaggccagccaccggcgatcgccggcatggaactgacc
gacaacctgatggcgttcgtcgagcgcaagctgttcaccctcaacaccggccacgccatc
accgcctacctcggccaacgggccgggctgcaaaccattcgcgacgccattctcgacccg
gcgatccgccgcgtggtgaaaggggcgatggaagagagcggcgcggtgctgatcaagcgt
tacggcttcgacgccgacaagcatgccgcctacatcaacaaaatcctcggccgctttgaa
aatccgtatctgcacgacgacgtcgagcgcgtagggcgccagccgctgcgcaaactgagc
gccggcgatcgcctgatcaaaccgctgctgggcacgctggaatacggcctgccgcatgcc
aacctgatccagggcatcgccgccgccatgagctaccgcagcgaacaggatccgcaggcg
caggaactggcggaactgctgaacacgctcgggccgaaagccgcgctggcgcaaatttcc
ggcctgccggcggaaagcgaggttgtagaagaggccgttgctgtgtataacgccatgcac
aagtag

DBGET integrated database retrieval system