KEGG   Serratia sp. SCBI: SERRSCBI_02570Help
Entry
SERRSCBI_02570    CDS       T03314                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sers  Serratia sp. SCBI
Pathway
sers00071  Fatty acid degradation
sers00072  Synthesis and degradation of ketone bodies
sers00280  Valine, leucine and isoleucine degradation
sers00310  Lysine degradation
sers00362  Benzoate degradation
sers00380  Tryptophan metabolism
sers00620  Pyruvate metabolism
sers00630  Glyoxylate and dicarboxylate metabolism
sers00640  Propanoate metabolism
sers00650  Butanoate metabolism
sers00900  Terpenoid backbone biosynthesis
sers01100  Metabolic pathways
sers01110  Biosynthesis of secondary metabolites
sers01120  Microbial metabolism in diverse environments
sers01130  Biosynthesis of antibiotics
sers01200  Carbon metabolism
sers01212  Fatty acid metabolism
sers02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sers00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SERRSCBI_02570
   00630 Glyoxylate and dicarboxylate metabolism
    SERRSCBI_02570
   00640 Propanoate metabolism
    SERRSCBI_02570
   00650 Butanoate metabolism
    SERRSCBI_02570
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SERRSCBI_02570
   00072 Synthesis and degradation of ketone bodies
    SERRSCBI_02570
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SERRSCBI_02570
   00310 Lysine degradation
    SERRSCBI_02570
   00380 Tryptophan metabolism
    SERRSCBI_02570
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SERRSCBI_02570
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SERRSCBI_02570
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SERRSCBI_02570
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sers04147]
    SERRSCBI_02570
Enzymes [BR:sers01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SERRSCBI_02570
Exosome [BR:sers04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SERRSCBI_02570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AIM20149
Position
587696..588880
Genome map
AA seq 394 aa AA seqDB search
MQQREVVIVAATRTRVGSFHGALAPLTAVELGTAAVQGLLAQSGVAPQQIDEVILGQVLT
AGCGQNPARQTALNAGLPFTTPALTINKVCGSGLKAVHLAVQAIRSGDADAVIAGGQESM
SRSPYLMAGARAGLRLGHAQMVDSVIHDGLWDAFNDYHMGITAENLAEKYAISREEQDRF
ALRSQQKALAAQQAGRFAQEITPVTVPQPKGEALRVERDEQPRDTSLEALARLRPAFRKE
GTVTAGNASSLNDGAAVVLLMSAEKAAALRLPVLARIAGYASLGVDPAIMGIGPAPAARR
CLEKAGWRLEEVDLIEANEAFAAQALAVGKELGWEAERVNVNGGAIALGHPIGASGCRIL
VSLLYEMQRREVNKGLAMLCIGGGQGVALAVERP
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgcaacaacgtgaagtggtgatcgtggcggcgacgcgcacgcgggtcggcagttttcac
ggcgcgctggcgccgctgacggcggtggaactgggcacggcggcggtgcaggggctgctg
gcgcaaagcggcgtggcgccgcagcagatcgatgaagtgatcctcggccaggtgctgacc
gccggctgcgggcagaatccggcgcgccagaccgcgctgaacgccgggctgccgtttacg
acgccggcgctgaccatcaacaaagtgtgcggctccgggttgaaggcggtgcatctggcg
gtgcaggcgatccgcagcggtgacgccgacgcggtgatcgccggcggccaggagagcatg
agccggtcgccttacctgatggccggcgcgcgcgccggtctgcgcctcggtcacgcgcag
atggtggacagcgtgatccacgatggcctgtgggacgcgttcaacgactatcacatgggc
atcaccgccgaaaacctggcggagaaatacgccatcagcagagaagaacaagacaggttc
gcgctgcgttcgcagcagaaggcgctggcggcgcagcaggccgggcgtttcgcgcaggag
atcacgccggtgacggtgccgcagccgaagggcgaagcgctgcgggtagagcgcgacgaa
cagccgcgcgacaccagcctggaggcgctggcgcggctgcgcccggcgtttcgcaaagag
ggcacggtgaccgccggcaacgcctcgtcgctcaacgacggcgccgccgtggtgctgctg
atgagcgcggaaaaagccgccgcgctgcgtttgccggtgctggcgcgcatcgccggttac
gcctcgttgggcgtcgatccggcgatcatgggcatcggcccggcgccggccgcgcgccgc
tgcctggaaaaagccggttggcggctggaggaggtcgatctgatcgaagccaacgaagcc
ttcgccgcgcaggcgctggcggtgggcaaagaactgggctgggaggcggagcgggtgaac
gtcaacggcggagcgatcgcgttggggcatccgatcggcgcgtccggctgccgcattttg
gtgtcgctgctgtacgaaatgcagcgccgcgaggtgaacaaggggctggcgatgctgtgc
atcggcggcgggcagggcgtggcgctggcggtagagcgcccgtaa

DBGET integrated database retrieval system