KEGG   Serratia sp. SCBI: SERRSCBI_03240Help
Entry
SERRSCBI_03240    CDS       T03314                                 

Gene name
apaG
Definition
(GenBank) CO2+/MG2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
sers  Serratia sp. SCBI
Brite
KEGG Orthology (KO) [BR:sers00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    SERRSCBI_03240 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AIM20278
Position
complement(729261..729638)
Genome map
AA seq 125 aa AA seqDB search
MIDSPRVCIQVQSIYVESQSIPEEERYVFAYTITIRNLGRTNVQLLGRYWLITNSNGRQT
EVQGEGVIGEQPVIPPGGEFQYTSGAILETPLGTMEGHYEMVDHQGQPFRTAIPVFRLAI
PTLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgattgattcgccccgcgtgtgtattcaggttcagagcatctatgtggaatcacagtcg
atccctgaagaagagcgttacgtcttcgcctataccattaccatccgcaatctggggcgg
accaacgtgcaactgctgggccgttactggctgatcaccaacagcaacggccgccaaacc
gaagtccagggcgaaggcgtgatcggcgaacagcccgtcattccgcccggtggagagttt
cagtacaccagcggcgccattctggaaacaccgctgggcaccatggaaggccattacgaa
atggttgaccatcagggtcagccgttccgcaccgctattcccgtgttccgcttagccatt
ccaacgctgatccattaa

DBGET integrated database retrieval system