KEGG   Serratia sp. SCBI: SERRSCBI_09860Help
Entry
SERRSCBI_09860    CDS       T03314                                 

Definition
(GenBank) sucrose-6-phosphate hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
sers  Serratia sp. SCBI
Pathway
sers00052  Galactose metabolism
sers00500  Starch and sucrose metabolism
sers01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sers00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SERRSCBI_09860
   00500 Starch and sucrose metabolism
    SERRSCBI_09860
Enzymes [BR:sers01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     SERRSCBI_09860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: AIM21584
Position
complement(2121921..2123363)
Genome map
AA seq 480 aa AA seqDB search
MNTALAQADHAVEALRAERRDDYYPQFHLAPAAGWINDPNGLICIDGVYHAFFQHHPHSE
HWGPMHWGHATSRDLIRWQHQPIALAPDAPYDQDGCFSGCAVDDNGVLTLLYTGHVWLGE
PGDDSQVREVQCLATSEDGIRFVKHGPVLAPPDGIQHFRDPKVWCENGEWWLVVGAKENG
LGQVRLYRSADLRAWRFDRVLAGAQTAHQGYMWECPDFFPLGEQHLLLFSPQGLAAQGYR
YRNRFQSGYLLGHWRPDGDFTVTQPFCELDAGHDFYAPQTFTAADGRRLLFAWMDMWESP
MPSKAHRWAGALTLPRELTLAADGSVRMNPARELAALRRGSQTLSAQTLTNQHLPLTNDM
QELILTLRPADSDAERYGLAIGSAARLFVDNQSHRLVLERFNEHPALCTCRSVPLPEGDI
LSLRIFIDRSSLEIFVNQGQACLTSRIYPTAGDRRLSLFAEGGQALFEPITGWQLASIWG
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaacactgctttagctcaagccgaccatgcggtcgaagccctgcgcgcagagcgccga
gacgattattatccgcagttccatctcgcaccggccgccggctggatcaacgatcccaac
ggcctgatctgtattgacggcgtctatcatgcgttcttccaacatcatccccatagcgag
cactgggggcccatgcactgggggcatgcgaccagccgcgatctgatacgctggcagcac
caacccatcgccctggcgcccgatgcgccctatgaccaagacggttgtttttccggctgc
gccgtggatgacaacggcgtgctgacgctgctttacaccggccacgtgtggttgggcgaa
cccggtgacgacagccaggtgcgggaagtgcaatgtctggccaccagcgaagacggcata
cgcttcgtcaaacacgggccggtgctggccccgccggacggcattcagcattttcgcgat
ccgaaagtctggtgcgagaacggcgaatggtggctggtggtcggcgccaaagaaaacggc
ctgggccaggtgcgcctgtaccgctcagccgacctgcgcgcctggcgcttcgatcgggtg
ctggccggcgcgcaaacggcgcatcagggctatatgtgggaatgcccggatttcttcccg
ctgggggagcaacacctgctgctgttttcgccgcaggggctggcggcgcagggctaccgc
taccgcaatcgcttccagagcggctatctgctcggccattggcggccggacggcgacttt
acggtaacgcagcccttctgcgagctggatgccggccacgatttctatgcgccgcagacc
ttcaccgccgccgacggccgtcggttgctgtttgcctggatggatatgtgggaatcaccg
atgcccagcaaagcgcaccgctgggccggcgccctcaccctgccacgcgagctgacgctg
gccgccgacggcagcgtccgcatgaatccggcgcgtgaactggcggcgttgcgccgagga
tcgcagacgttgtcggcgcagacgctgaccaatcagcatctgccgctgacgaacgatatg
caggagctcatcctgacgttgagaccggccgacagcgacgccgagcggtacgggctggcc
attgggagtgcggcgcggctgttcgtcgacaatcagtcacaccgactggtgctggagcgt
tttaatgaacacccggcgctgtgcacctgccgcagtgtgccgctgccggagggtgacatc
ctgtcgctgcggatctttatcgatcgctcctcgctggagatcttcgttaatcaggggcag
gcctgcctgaccagccgcatctatccgacggcgggcgatcgccgcctcagcctgttcgcc
gaaggcggccaggcgctgttcgagcccatcacgggatggcagttggcaagcatctggggg
taa

DBGET integrated database retrieval system