KEGG   Salmonella enterica subsp. arizonae: SARI_00511Help
Entry
SARI_00511        CDS       T00627                                 

Definition
(GenBank) hypothetical protein
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
ses00071  Fatty acid degradation
ses00280  Valine, leucine and isoleucine degradation
ses00281  Geraniol degradation
ses00310  Lysine degradation
ses00362  Benzoate degradation
ses00380  Tryptophan metabolism
ses00410  beta-Alanine metabolism
ses00640  Propanoate metabolism
ses00650  Butanoate metabolism
ses00903  Limonene and pinene degradation
ses00930  Caprolactam degradation
ses01040  Biosynthesis of unsaturated fatty acids
ses01100  Metabolic pathways
ses01110  Biosynthesis of secondary metabolites
ses01120  Microbial metabolism in diverse environments
ses01130  Biosynthesis of antibiotics
ses01200  Carbon metabolism
ses01212  Fatty acid metabolism
Module
ses_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ses00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SARI_00511
   00650 Butanoate metabolism
    SARI_00511
  Lipid metabolism
   00071 Fatty acid degradation
    SARI_00511
   01040 Biosynthesis of unsaturated fatty acids
    SARI_00511
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SARI_00511
   00310 Lysine degradation
    SARI_00511
   00380 Tryptophan metabolism
    SARI_00511
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SARI_00511
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SARI_00511
   00281 Geraniol degradation
    SARI_00511
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SARI_00511
   00930 Caprolactam degradation
    SARI_00511
Enzymes [BR:ses01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SARI_00511
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SARI_00511
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SARI_00511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: ABX20437
UniProt: A9MJ37
Position
510832..512976
Genome map
AA seq 714 aa AA seqDB search
MTTSAFTLNVRLDNVAVVSIDVPGEKVNTLKAEFAAQARAILKQIRENKVLQGVVFISAK
ADNFIAGADINMIGRCQSAQEAETLARQGQQLMAEIQALPVPVIAAIHGACLGGGLEMAL
ACHRRICTDDVKTVLGLPEVQLGLLPGSGGTQRLPRLVGVSTALDMILTGKQLRARQALK
TGLVDDVVPQTILLEAAVELAKKDRLAQRTLPVRERILAGALGRTLLFRLVRKKTAQKTQ
GNYPATERIIDVIETGLAQGSGNGYDAEACAFGELAMTPQSQALRNLFFASTQVKKDPGS
DAPSGPLNSVGILGGGLMGGGIALVTACKGGLPVRIKDINAKGINHALKYSWDQLETKVR
RRHIKASERDKQLALISGSTDYRGFSHRDLIIEAVFEDLSLKQQMVAEVEQNCASHTIFA
SNTSSLPIGDIAAYAGRPEQVIGLHFFSPVEKMPLVEVIPHASTSAQTIATTVKLAKKQG
KTPIVVSDKAGFYVNRILAPYINEAIRMLTEGERVEHIDAALVKFGFPVGPIQLLDEVGI
DTGTKIIPVLEAAYGERFSAPANVVASILNDGRKGRKNGRGFYLYGEKGRESKKKVDNAI
YKVIGVQGQSRLSAHQVAERCVMLMLNEAARCFDEKVIRSARDGDIGAVFGIGFPPFLGG
PFRYMDALGPGEVVATLQRLAALYGPRYAPCEQLMRMAERGEHFWMNEETDQGN
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgaccacatcagcttttacgcttaacgtgcgcctggataatgtcgcggttgtctctatt
gatgtcccaggggaaaaggtaaataccctgaaagcggagtttgccgcgcaggcgcgcgcc
atcctgaagcagatccgcgaaaataaagtgttgcagggcgttgtttttatctcggccaaa
gcagataactttattgctggcgccgatatcaacatgatagggcgctgccaaagcgcgcag
gaagcggaaacgctggcgcgtcagggacagcaacttatggcggagatccaggcgttgcct
gttccggtcatcgccgctattcacggcgcctgtctgggcggcggtcttgaaatggcgctg
gcctgccatcggcgtatctgtacagatgacgttaaaactgttctcgggctgccggaagta
cagttagggcttttgccgggatcgggcggaacacagcgccttcctcggctggtgggggtc
agcaccgcgctggatatgatcctgacaggtaaacagcttcgcgccagacaggcgcttaaa
acagggctggttgatgacgtggtgccgcagactattttactggaagcggcagtcgaactg
gctaaaaaagaccgcctggcgcagcggacattaccggtccgtgaacgtatcctggcgggg
gcgctggggcggacgctgctatttcgcctggtgcgtaaaaagacggcgcagaaaacgcag
ggtaattatccagcgacggagcggatcattgacgtgatagaaaccggactggcgcagggc
agcggtaacggctatgacgcggaggcgtgtgctttcggcgagctggcgatgacgcctcaa
tcgcaggcgctgcgtaatcttttctttgccagtacccaagtgaaaaaagatcccggtagc
gatgcgccgtccggcccgctgaacagcgtaggcatattgggcggcgggttaatgggcggc
ggtatcgccctggtcacggcctgtaaaggcggcttgccagtacgtattaaggatataaat
gctaagggaatcaatcatgcactgaagtatagttgggaccagcttgaaacaaaagtacgc
cgtcgccatatcaaagccagcgaacgcgataaacaattggcgctgatatcaggctcgact
gattaccgtggtttcagtcatcgcgatctgataattgaagcggtgtttgaagatctgtcg
ttaaaacaacagatggtggcggaagtggagcaaaattgcgcctcccacaccatttttgcg
tccaatacctcttccttgccgattggcgatattgcggcgtacgcgggcagaccggaacag
gtgattggattgcacttttttagcccggtcgaaaaaatgccgctggtcgaggtcattccc
catgcgtctacttccgcgcagaccatcgccacgaccgttaagctggcgaaaaaacagggt
aaaaccccgatcgtcgttagcgataaagctgggttttatgttaaccgaattctcgcgccg
tatattaatgaagcgattcggatgctgactgaaggcgaacgtgtcgaacatattgatgcc
gccctggtaaagtttggttttccggtggggccaatccaacttttggatgaggtcggaatc
gacacgggcactaaaattattcctgtgcttgaggcagcttatggagaacgttttagcgcg
ccagcaaatgttgttgcttcaattttgaatgacggtcgcaaaggtagaaaaaatggtcgc
ggtttctatctttatggcgaaaaagggcgtgaaagcaaaaaaaaggttgacaatgcgatt
tataaggttattggcgtgcaagggcaaagtcggctgtctgcgcatcaggtggcagagcgc
tgtgtcatgttaatgctcaatgaagcggcgcgctgtttcgacgaaaaagtaattcgcagc
gcgcgcgatggcgatattggcgccgtgtttggtattggttttcctccgtttctcggcggc
ccgtttcgttatatggatgctctcgggccgggtgaagtggtagcgaccttgcagcgcctg
gccgcactttacggccctcgttacgcgccttgtgaacaattaatgcgcatggcggagcgc
ggggagcatttctggatgaatgaggaaactgaccagggaaattaa

DBGET integrated database retrieval system