KEGG   Salmonella enterica subsp. arizonae: SARI_00548Help
Entry
SARI_00548        CDS       T00627                                 

Definition
(GenBank) hypothetical protein
  KO
K10017  histidine transport system ATP-binding protein [EC:7.4.2.1]
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
ses02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ses00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SARI_00548
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ses02000]
    SARI_00548
Enzymes [BR:ses01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     SARI_00548
Transporters [BR:ses02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    SARI_00548
   Histidine transporter
    SARI_00548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 AAA_29 AAA_13 ABC_ATPase AAA_16 AAA_23 PRK G-alpha AAA_33 cobW NACHT RsgA_GTPase FtsK_SpoIIIE AAA_24 AAA_22
Motif
Other DBs
NCBI-ProteinID: ABX20474
UniProt: A9MJ74
Structure
PDB: 

Position
547230..548006
Genome map
AA seq 258 aa AA seqDB search
MMSENKLNVIDLHKRYGGHEVLKGVSLQASAGDVISIIGSSGSGKSTFLRCINFLEKPSE
GAIIVNGQNINLVRDKDGQLKVADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPVQ
VLGLSKHDARERALKYLAKVGIDERAQGKYPVHLSGGQQQRVSIARALAMEPDVLLFDEP
TSALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSSHVIFLHQGKIEEEGEPEQV
FGNPQSPRLQQFLKGSLK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcagaaaataaattaaacgttatcgatttgcacaaacgctacggcggtcatgaa
gtgctaaaaggggtatctttgcaggccagcgctggagatgtgattagcatcatcggttcg
tccggttccggtaaaagcacctttttgcgctgcattaacttcctcgaaaaaccgagcgaa
ggcgcgattatcgtgaacggtcagaacattaatctggtgcgtgacaaagacgggcagctc
aaagttgcggataaaaatcagctacgtctgttgcgtacccgtctgacgatggtgtttcag
cattttaacctctggagccatatgacggtgctggaaaatgtgatggaggcgccggttcag
gtactgggattaagcaagcacgacgcgcgggagcgggcgctgaaatatctggcgaaggtc
gggattgatgagcgcgctcagggcaaatatcctgtccatctctcaggcggtcaacaacag
cgcgtttctattgcgcgcgcgctggcgatggaacctgacgttttactgttcgatgaaccc
acttcggcgctcgatcctgaactggtcggcgaagtgttgcgcatcatgcaacaactggcg
gaagaaggcaaaacgatggtggtggtcacgcatgaaatgggcttcgcccgccatgtctct
tcgcacgttatttttctgcatcaggggaaaattgaagaagagggcgagccggaacaggtg
ttcggcaatccgcaaagcccgcgtctacagcagttcctgaaaggttcgctgaaataa

DBGET integrated database retrieval system