KEGG   Salmonella enterica subsp. arizonae: SARI_00661
Entry
SARI_00661        CDS       T00627                                 

Definition
(GenBank) hypothetical protein
  KO
K06899  nucleoid-associated protein
Organism
ses  Salmonella enterica subsp. arizonae
Brite
KEGG Orthology (KO) [BR:ses00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ses03036]
    SARI_00661
Chromosome and associated proteins [BR:ses03036]
 Prokaryotic type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    SARI_00661
SSDB
Motif
Pfam: NA37
Other DBs
NCBI-ProteinID: ABX20584
UniProt: A9MK26
Position
678679..679686
AA seq 335 aa
MSLDINQIALHQLIKRDEQNLELVLRDSLLEPTATVVEMVAELHRVYSAKNKAYGLFNEE
SELAQALRLQRQGEEDFLAFSRAATGRLRDELTKYPFADGGIVLFCHYRYLAVEYLLVAV
LNNLSSMRVNENLDINPTHYLDINHADIVARIDLTEWETNPESTRYLTFLKGRVGRKVAD
FFMDFLGASEGLNAKAQNRGLLQAVDDFTAEAQLDKAERQNVRRQVYSYCNERLQAGEEI
ELESLSKELSCVSEVSFSEFTAEKGYELEESFPADRSTLRQLTKYAGSGGGLTINFDAML
LGERIFWDPATDTLTIKGTPPNLRDQLQRRTSGGK
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgagtctggatatcaaccagattgccctgcaccagcttatcaagcgtgatgagcaaaat
cttgaactggtcttgcgcgattcattgctggagccaacagccaccgttgtcgaaatggtg
gctgaactgcatcgggtctatagcgccaagaataaggcgtatggactgtttaacgaagag
agtgaactggcgcaggcgctgcggttgcaacgtcagggagaagaagattttctcgctttt
agccgggcagcgaccggacgcttgcgtgacgaactgacgaaatatccctttgcggacggc
ggcattgtgctgttctgccactatcgctacctggcggtggagtatctgctggttgcggta
ctgaacaacctgagcagtatgcgggtgaatgaaaatctggacattaacccgacgcattac
cttgatattaaccatgcggatatcgtagcgcgtatcgatcttaccgagtgggaaacaaat
ccggaatcgacccgttatctgacgtttctgaaagggcgggtggggcgcaaggtcgctgac
ttctttatggatttcctcggcgccagcgaagggctgaatgcaaaagcgcagaaccgcggt
ctgttgcaggcggtggatgatttcactgcagaagcgcagttggataaagcagaacgacag
aacgtgcgtcggcaggtttacagctactgcaacgagcggttacaagccggggaagagatt
gagctggaatcgctatcgaaagagctttcctgcgtcagtgaggtaagcttcagcgaattt
actgccgaaaaaggctatgagctggaagagagctttccggctgatcggagtacgctacgc
cagctaacgaaatatgccggaagcggcggcgggttaaccattaactttgatgcgatgcta
ctgggtgagcggattttctgggacccagcgaccgatacgctgaccatcaaaggaacgccg
ccgaatttgcgcgatcagttgcaacgtcgcacatcgggcggaaagtaa

DBGET integrated database retrieval system