KEGG   Salmonella enterica subsp. arizonae: SARI_00869Help
Entry
SARI_00869        CDS       T00627                                 

Definition
(GenBank) hypothetical protein
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
ses00860  Porphyrin and chlorophyll metabolism
ses01100  Metabolic pathways
Module
ses_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:ses00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SARI_00869
Enzymes [BR:ses01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     SARI_00869
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 AAA_26 CbiA SNO GATase Peptidase_C26
Motif
Other DBs
NCBI-ProteinID: ABX20788
UniProt: A9MLS5
Position
882272..883792
Genome map
AA seq 506 aa AA seqDB search
MTQAVMLQGTASDVGKSVLAAGLCRIFYQDGLRTAPFKSQNMALNSGITPDGKEMGRAQI
FQAEAAGIMPDVRMNPVLLKPTSDRQAQIVLMGKVATNMDAVSYHDYKPRLREQILAVYN
SLAREYDVIVLEGAGSPAEINLRDRDIVNMGMAEMAQCPVILVADIDRGGVFAAIYGTLA
LLHKQERDRVKGVIINKFRGDVALLYSGIEQIESLTGVPVLGVMPWLDVDLEDEDGVTLQ
NGKYKGNDDRDITIAIVQLPHISNFTDFNALAAQPDVRIRYVRRPEELADVDLAILPGSK
NTLSDLAWLRESGMADAVLQTHRQGVPVMGICGGYQMLGDTIVDEVESGLGTQPGLGLLN
TITRFAQDKTTTQVNATMSGELPGWLAAAAGLPVRGYEIHMGETVLQEGCCTAMTLQKNG
CPVADGAVTADGLAFGTYLHGLFDSDAFTRAVVNGLRARKGLAPWETTFCYAEHKARQFD
LLAEAMRQHIDIDKIYTIMQQHQEPV
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaggcagttatgttgcaggggacggcatctgacgtcggaaaaagtgtgctggcg
gcgggtttatgccgcattttttatcaggatggtctgcgtaccgcgccgtttaaatcgcaa
aatatggcgcttaattctggtattacgccggatggtaaagagatggggcgggcgcagatt
tttcaggcggaagccgcggggatcatgccagatgtgcgtatgaatccggtgctgctcaaa
ccgaccagcgatcgccaggcgcagatcgtgctgatggggaaagtggcgaccaatatggat
gcggttagttaccatgactataagccacgtttgcgtgagcaaattcttgcggtctataac
agcctggcgcgggaatatgacgttatcgtgctggaaggcgccggcagcccggcggaaatc
aatctacgcgatcgtgatatcgtcaatatgggaatggcggaaatggcgcagtgtccggtt
attctggtggcggatatcgatcggggcggcgtattcgccgctatctatggcacgctggcg
ctgctgcataaacaggagcgtgacagagtaaagggcgtcattatcaacaaattccgcggc
gatgtggcgctgctctattccggtatcgaacaaatcgaatcgcttaccggggttcctgtc
ctgggggtgatgccgtggctggatgtggatctggaagatgaagatggcgtcacgctgcaa
aacggtaaatataagggaaacgacgatcgtgatatcaccattgcaatcgtgcaactgccg
catatttctaactttacggattttaacgctctggcggcccagccggacgtccgcatacgt
tatgtccgccgcccggaagagttagctgacgttgatttggcgatcctgccgggcagtaag
aatacgctgagcgacctcgcctggctgcgcgaaagcgggatggcggatgcggtattgcag
acacatcggcagggcgtgccggtgatgggaatttgcggcggctaccagatgctgggcgac
accattgtggatgaggtggagtcggggctgggtacgcagccgggcctggggctgcttaat
acgatcactcgctttgcacaggataaaactacgacgcaggttaacgcgacaatgtcaggc
gagctgcccggctggctggctgccgcggcagggctaccggtacgcggttatgaaatccac
atgggggaaacggtgctgcaggaaggatgctgtacggccatgacgttacagaaaaatgga
tgtcctgtggcggatggcgcggtcaccgccgacggactggcgtttggcacttaccttcac
ggcctgtttgacagcgatgcgtttacccgtgcggtggtcaatgggttacgggcgcgaaaa
ggacttgcgccgtgggaaacgactttttgttatgcggagcataaagcgcggcaatttgat
ctgctggcggaagcgatgcggcaacatattgatattgataaaatttataccatcatgcag
caacatcaggagccggtatga

DBGET integrated database retrieval system