KEGG   Salmonella enterica subsp. arizonae: SARI_01174Help
Entry
SARI_01174        CDS       T00627                                 

Definition
(GenBank) hypothetical protein
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
ses00900  Terpenoid backbone biosynthesis
ses01100  Metabolic pathways
ses01110  Biosynthesis of secondary metabolites
ses01130  Biosynthesis of antibiotics
Module
ses_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:ses00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SARI_01174
Enzymes [BR:ses01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     SARI_01174
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ABX21079
UniProt: A9MP98
Position
complement(1139578..1140429)
Genome map
AA seq 283 aa AA seqDB search
MMTYWPSPAKLNLFLYITGQRADGYHTLQTLFQFLDYGDTLHIEPRRDGEIHLLTPVNGV
ENEDNLIVRAARGLMKAALESGRLPAGSGADISIEKRLPMGGGLGGGSSNAATVLVALNH
LWQCGLSVDELAKLGLTLGADVPVFVRGHAAFAEGVGEILTPVNPPEKWYLVAHPGVIIP
TPVIFKDPQLPRNTPKRSIDTLLKCEFSNDCEVIARKRFREVDAALSWLLEYAPSRLTGT
GACVFAEFDTEPCARQVLEQAPEWLNAFVAKGVNLSPLHRSLL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgatgacctactggccctccccggcaaaattaaatctgtttttatatatcaccggacag
cgtgcggacggctaccacacgctgcagacgctgtttcagtttctggattacggcgacaca
ctacacattgagccgcgtcgcgatggcgaaattcatttattaaccccggttaacggcgtt
gaaaacgaagacaacctgatcgtccgcgccgcgcgagggttgatgaaagccgccctggag
agtggacgtctgcccgccggaagcggcgcggatatcagtattgagaagcgtttgccgatg
ggcggcgggctgggcggcggttcgtctaatgccgcaaccgttctggtggcgctcaatcat
ctttggcaatgcgggctttccgttgatgaactggcgaagctcggcctgacgctcggcgca
gatgtcccggtctttgttcgtggtcacgctgcctttgccgaaggcgtaggcgagatatta
acgcctgtgaatccgccggaaaaatggtatctggtggcgcaccctggcgtcattattccg
acgccggttatctttaaagatccacaattgccgcgcaatacaccaaaaagatcaatagac
acgttactaaaatgtgaattcagcaatgattgcgaggttatcgcaagaaaacgttttcgc
gaggttgatgcggcgctttcctggctgttagaatacgcgccgtcgcgcctgactgggaca
ggggcctgtgtctttgctgaattcgatacagaaccttgtgctcgccaggtgcttgagcaa
gccccggaatggctcaatgcttttgtggcgaagggtgtcaacctctccccattgcacaga
tcgttactttaa

DBGET integrated database retrieval system