KEGG   Salmonella enterica subsp. arizonae: SARI_01230Help
Entry
SARI_01230        CDS       T00627                                 

Definition
(GenBank) hypothetical protein
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
ses00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ses01100  Metabolic pathways
ses01110  Biosynthesis of secondary metabolites
ses01130  Biosynthesis of antibiotics
ses01230  Biosynthesis of amino acids
Module
ses_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ses00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SARI_01230
Enzymes [BR:ses01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SARI_01230
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     SARI_01230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI
Motif
Other DBs
NCBI-ProteinID: ABX21132
UniProt: A9MPY8
Position
complement(1191676..1193034)
Genome map
AA seq 452 aa AA seqDB search
MQTVLAKIVADKAIWVEARKQQQPLASFQNEIQPSTRHFYDALQGARTAFILECKKASPS
KGVIRDDFDPARIAGIYQHYASAISVLTDEKYFQGSFDFLPVVSQSAPQPILCKDFIIDP
YQIYLARYYQADACLLMLSVLDDEQYRQLAAVAHSLKMGVLTEVSNDAERERAMALGAKV
VGINNRDLRDLSIDLNRTRQLAPKLGHGVTVISESGINTYGQVRELSHFANGFLIGSALM
AHDDLNAAVRRVLLGENKICGLTRAQDAKAAYDAGAVYGGLIFAPASPRVVNIDQAREII
AAAPLQYVGVFQDADIADVCQKAAVLSLSAIQLHGSENQAYVNALREALPRDLQIWKALS
VGDTLPARDYHHVDKYIFDNGQGGSGQRFDWSLLQGQPLDNVLLAGGLAADNCVQAAQAG
CAGLDFNSGVEAQPGIKDARLLASVFQTLRAY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccgttttagcgaaaatcgtcgcagacaaggcgatttgggtagaagcccgcaaa
cagcaacagccgctggccagttttcaaaatgagatccagccaagtacacgccatttttat
gatgcgctccagggcgcgcgtaccgcctttattctggagtgtaagaaagcatcgccatca
aaaggcgtgattcgcgatgatttcgatccggcgcgtattgccggtatttatcaacattac
gcctcggcgatctcggttctcaccgacgaaaaatattttcaggggagcttcgattttctg
ccggtcgttagccaaagcgcgccgcagccgattctgtgtaaggattttattatcgatccc
tatcagatctaccttgcccgttactatcaggccgatgcctgtttactgatgctctcagtt
ctggatgacgagcagtatcgccaactcgccgccgtcgcgcacagtctgaaaatgggcgta
ctcacggaagtcagtaatgacgcagaacgggagcgcgcgatggcgttaggcgcaaaagtg
gtaggtatcaacaatcgcgatctgcgcgatctgtcgattgatttgaatcgcacccgccag
ctggcgccaaaactgggccacggcgtgaccgtcatcagtgagtccggaattaacacttac
ggtcaggtgcgcgagctgagtcacttcgccaacgggtttttgattggttccgcgttaatg
gcgcatgacgatcttaacgccgccgtccgtcgcgtgctgctcggcgaaaataaaatctgc
ggtctgacccgcgcccaggacgccaaagccgcctatgacgctggcgccgtctacggtgga
ttgattttcgctcccgcctcgcctcgtgtcgtcaatatcgaccaggcgcgggagataatc
gccgccgcgccgttacagtatgttggggttttccaggacgctgatatcgcagatgtttgc
cagaaagccgccgtcctgtcgttgtctgctatacagctacacggcagcgaaaaccaggcg
tatgtcaacgcgctgcgcgaggcgttgccgcgcgatttgcaaatctggaaggcgctgagc
gtcggcgatacccttcccgcgcgcgattatcaccatgtcgataaatacattttcgacaat
ggacaaggcggcagcggacaacgcttcgactggtcgctgctacaggggcaaccgctggat
aatgtgttactggcgggcgggctggcggccgataactgtgtccaggcggcgcaagccggc
tgtgccggtctcgattttaattctggtgtggaggcacagccaggcatcaaagatgctcgt
cttctggcctcggtttttcagacactgcgcgcatattaa

DBGET integrated database retrieval system