KEGG   Salmonella enterica subsp. arizonae: SARI_01284Help
Entry
SARI_01284        CDS       T00627                                 

Definition
(GenBank) hypothetical protein
  KO
K22597  glucosylglycerate phosphorylase [EC:2.4.1.352]
Organism
ses  Salmonella enterica subsp. arizonae
Brite
Enzymes [BR:ses01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.352  glucosylglycerate phosphorylase
     SARI_01284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase
Motif
Other DBs
NCBI-ProteinID: ABX21186
UniProt: A9MQ42
Position
1238652..1240340
Genome map
AA seq 562 aa AA seqDB search
MKVNQKIEKYLSEIYGKTFTPRHYEALNSRIEKARLLISKKRKTHWDERDVVLITYADQF
HSDTSKPLPTFNKFHRQWLAATFSHLHLLPFCPWSSDDGFSVVDYYQVAPETGDWEDISD
LSQSSQLMFDFVCNHMSAKSEWFNHYLQQAPGFENFFIAVDPSTDLSAVTRPRALPLLTP
FTLKDKSVHHLWTTFSDDQIDLNYRCPDVLLAMVDVLLTYLEKGADYIRLDAVGFMWKIP
GTTCIHLPQTHLLIKLFRAITDDVAPGTVIITETNVPHKDNIAYLGNGEDEAHMVYQFSL
PPLVLHAVHGQDVRALCSWAQSLTLPSENTTWFNFLASHDGIGLNPLRGLLPEDEILKLV
EDLQQEGALVNWKNNPDGSRSPYEINVTYMDALSDRYSTDDQRLARFILAHAILLSFPGV
PAIYIQSILGSRNDYDGVTQLGYNRAINRKKYRRTEIEAELMDETTLRYRVYHALSRLIE
IRRNNKAFHPESQFSIKNISPCVMQIERVAKTGESIVALFNVSDNINTINSKKFQGTDLI
SETNLTGEVLTLHPWQVLWIKK
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgaatcaaaaaatcgagaaatacctgtcagaaatctatggaaagacatttacg
ccacgacattacgaggcgctgaactcacgcattgaaaaagcacgattattaatttcaaaa
aagcgtaaaacgcactgggacgaaagggatgtggtgctcattacttacgctgaccagttt
cacagtgatacatcaaagccgttaccaacatttaataaatttcatcgacaatggctggcg
gctactttttctcatctccatctattacctttttgtccgtggtcttcggatgacggtttt
tcagtcgtagattattatcaggtcgcacctgaaacgggcgattgggaagatatcagtgat
ctcagccagagcagtcaacttatgtttgactttgtttgcaatcatatgtcggcaaagagt
gagtggttcaaccattatttgcaacaagcgcctggctttgaaaatttctttattgccgta
gacccatcaaccgatcttagcgcagtcacccgaccacgcgccttaccgttgctcacgcca
tttaccctgaaggacaagtctgttcatcatctatggacaaccttcagcgatgaccagatt
gatctcaactatcgttgtccggatgttttgctggcgatggtcgatgtactgctgacttat
ttagagaaaggggctgattatatccgtctggacgcggtagggtttatgtggaaaataccg
ggtaccacctgtattcatttaccacagacacatctgctgattaagctctttcgcgctatt
acggatgacgtcgcgccaggtacggtcattattactgagaccaatgttccgcataaagac
aacattgcatatctggggaacggcgaagatgaagcgcatatggtctatcagttttcactg
ccgccgctggtgcttcatgccgttcacggccaggatgtacgcgcgctgtgttcatgggcg
caatctttgacgcttccctcagaaaatacgacctggttcaatttccttgcgtctcatgac
ggtattgggcttaatccattacgcggtcttttgccggaagacgagatactgaagctggta
gaggacttacaacaagaaggcgcgctggttaactggaaaaataacccggacggtagccga
agcccttatgaaataaacgtgacgtatatggatgcgcttagcgatcgatatagtactgac
gatcaacgcctcgccagatttattctggctcacgccattttactctcttttccaggcgtg
ccggcgatatatatacaaagtattctgggttcccgtaacgattatgacggcgtgacacaa
ctggggtataaccgggcgattaatagaaagaaataccggcgcacagaaattgaagcggaa
ttaatggatgagacaacgttaagatatcgcgtctatcatgccttatccagacttatcgag
attcggcgaaataataaagcttttcatccagaaagccaattttccattaaaaatatatca
ccttgtgttatgcaaatagagagagtggcaaaaacgggagagtccattgtcgctttgttt
aatgtcagcgataacataaataccattaatagtaaaaagtttcagggtactgatttaatt
agcgaaacgaatctcaccggcgaggtattaacgctacacccctggcaggttctgtggatt
aaaaaataa

DBGET integrated database retrieval system