KEGG   Salmonella enterica subsp. arizonae: SARI_01941
Entry
SARI_01941        CDS       T00627                                 

Definition
(GenBank) hypothetical protein
  KO
K09911  uncharacterized protein
Organism
ses  Salmonella enterica subsp. arizonae
Brite
KEGG Orthology (KO) [BR:ses00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    SARI_01941
SSDB
Motif
Pfam: MatP MatP_C RHH_4 TMF_TATA_bd
Other DBs
NCBI-ProteinID: ABX21823
UniProt: A9MHT3
Position
complement(1863479..1863931)
AA seq 150 aa
MKYQQLENLESGWKWKYLVKKHREGELITRYVEASAAQEAVNLLLALENEPVRVNVWIDR
HMNPALLNRMKQTIRARRKRHFNAEHQHTRKKSIDLEFMVWQRLAGLAQRRGKTLSETIV
QLIEDAEHKEKYATTMSTLKQDLQALLGKK
NT seq 453 nt   +upstreamnt  +downstreamnt
atgaaatatcaacaacttgaaaatcttgaaagcggttggaaatggaaatatctggtgaaa
aagcaccgcgaaggggagttgatcacccgctacgtggaagccagcgctgcccaggaagcc
gtcaatttgttgttggccctcgaaaatgaaccggtgcgggtaaatgtctggattgacagg
catatgaatcctgccttgcttaatcggatgaaacaaacgatccgggcaagacgcaaacga
cactttaatgcggaacatcaacatacgcgtaaaaaatctatcgatttagagtttatggtc
tggcagcgtctggcgggccttgcgcagcgacgcggtaaaacattatccgaaacgattgtg
caactcatagaggatgcggagcataaagaaaaatacgcgacgacgatgagtacgttgaag
caggatttacaggcgttattaggcaaaaaatag

DBGET integrated database retrieval system