KEGG   Salmonella enterica subsp. arizonae: SARI_02127Help
Entry
SARI_02127        CDS       T00627                                 

Definition
(GenBank) hypothetical protein
  KO
K03702  excinuclease ABC subunit B
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
ses03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ses00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    SARI_02127
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ses03400]
    SARI_02127
DNA repair and recombination proteins [BR:ses03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     SARI_02127
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      SARI_02127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrB_inter UvrB Helicase_C ResIII UVR DEAD AAA_30 UB2H IF2_N
Motif
Other DBs
NCBI-ProteinID: ABX22004
UniProt: A9MJE1
Position
complement(2060906..2062927)
Genome map
AA seq 673 aa AA seqDB search
MSKPFKLNSAFKPSGDQPDAIRRLEEGLEDGLAHQTLLGVTGSGKTFTIANVIADLQRPT
MVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYYDYYQPEAYVPSSDTFIEKDASVNEHIE
QMRLSATKALLERRDVVVVASVSAIYGLGDPDLYLKMMLHLTVGMLIDQRAILRRLAELQ
YTRNDQAFQRGTFRVRGEVIDIFPAESDDIALRVELFDEEVERLSLFDPLTGQVEATVPR
YTIYPKTHYVTPRERILQAMEEIKDELADRRKVLLANNKLLEEQRLSQRTQFDLEMMNEL
GYCSGIENYSRFLSGRGPGEPPPTLFDYLPADGLLVVDESHVTIPQIGGMYRGDRARKET
LVEYGFRLPSALDNRPLKFEEFEALAPQTIYVSATPGNYELEKSGDEVVDQVVRPTGLLD
PIIEVRPVATQVDDLLSEIRQRAVINERVLVTTLTKRMAEDLTEYLEEHGERVRYLHSDI
DTVERMEIIRDLRLGEFDVLVGINLLREGLDMPEVSLVAILDADKEGFLRSERSLIQTIG
RAARNVNGKAILYGDKITPSMAKAIGETERRREKQQKYNEEHGITPQGLNKKVVDILALG
QNIAKTKAKGKGKGRSTAKTGIVELDMTPKALQQKIHELEGQMMQHAQNLEFEEAAQIRD
QLHQLRELFIAAS
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaccgtttaaactgaattccgcttttaaaccttctggcgatcagccggacgct
atacgtcgcctggaagaggggctggaggacgggctggcgcatcagacgttattgggagta
accggctccgggaagacattcaccattgccaacgttattgcggacttgcagcggccaacg
atggtgcttgcgcctaacaaaactctggcggcgcagctctacggcgaaatgaaagagttt
tttccggaaaatgcggtggagtattttgtctcctactatgactactatcagccggaagcg
tatgtgccaagttcggatacgtttatcgaaaaagacgcttcggtaaacgaacatattgag
caaatgcggctgtcggcaacgaaagctctgcttgagcgacgcgatgtcgtggtggtggct
tccgtgtccgcgatttacggtttgggagatccggatctttacctgaaaatgatgttgcac
ctcacagtcggaatgctgattgatcagcgcgcgatcttgcgtcggctggcggaattgcaa
tacacccgtaacgatcaagcctttcagcgcggtaccttccgcgtgcgcggcgaagtaatc
gatatcttcccggctgaatctgacgatatcgcgctacgcgttgagctgtttgatgaagaa
gtggaacgcctgtcgctgtttgacccattaaccgggcaggtggaggcaacggtgccacgt
tataccatctatcccaaaacacactatgtgacgccgcgcgagcgtattctacaggcgatg
gaagagataaaagatgaactggcggacaggcgtaaggttcttttagcgaataataagctg
cttgaagagcagcgattaagccagcgcacgcagtttgatttagagatgatgaacgagctg
ggctactgctcaggcattgaaaactattctcgcttcctgtcgggccgcgggccgggcgaa
ccgccgccaaccttgttcgattatctgcccgccgacggactgctggtggtggatgagtct
cacgtaacgatcccgcagataggcggcatgtatcgcggcgaccgggcgcgtaaagagacg
ctggtcgagtatggtttccgtctgccttcagcgttggataaccgtccgctgaagtttgaa
gagtttgaagccttagcgccgcaaactatctatgtttccgccacgcctggcaactatgag
ctggaaaagtcgggtgatgaggtggtggatcaggttgtgcgaccgaccgggctactggac
ccgatcattgaagtgcgcccggtggcgacccaggtggacgatctgctttctgaaatccgt
cagcgtgcggttattaacgagcgtgttcttgtaaccacactcaccaaacggatggcggaa
gatttgactgaatatctggaagaacacggcgagcgcgtacgctatctgcactcggatatt
gataccgtggagcgtatggaaatcatccgcgatttgcgtctgggcgagtttgacgttctg
gtggggattaacttgctgcgcgaagggctggatatgccggaagtctctctggtggcgatt
ctggacgccgacaaagagggcttcctgcgttccgagcgctccctgattcagaccataggt
cgcgcggcgcgtaacgttaacggtaaagcgattctgtacggcgataaaatcacgccgtca
atggcgaaggcgattggcgaaaccgagcgtcgtcgcgagaagcagcagaagtacaacgaa
gagcatggtatcacgccgcaggggctgaacaaaaaagtggttgatatcctggcgctgggg
cagaacattgcgaaaaccaaagcgaaggggaaaggcaaaggccgttctacggcgaaaacc
gggattgtcgaactggatatgacgccaaaagcgttgcagcagaaaattcatgagctggaa
gggcaaatgatgcagcacgcgcagaatctggagtttgaagaagccgcgcaaattcgcgac
cagttgcatcagctacgcgagttgtttatcgcggcgtcctga

DBGET integrated database retrieval system