KEGG   Salmonella enterica subsp. arizonae: SARI_02603
Entry
SARI_02603        CDS       T00627                                 

Definition
(GenBank) hypothetical protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
ses03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ses00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SARI_02603
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ses02044]
    SARI_02603
Secretion system [BR:ses02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SARI_02603
SSDB
Motif
Pfam: Phage_GPD Pyocin_S DUF2345 T6SS_Vgr Phage_base_V
Other DBs
NCBI-ProteinID: ABX22460
UniProt: A9MMY5
Position
complement(2520159..2523749)
AA seq 1196 aa
MDNWLALFDGQTRYFLDINDSSVKPDVLRFYGREALSEPFRWDIEFTTLQANIPPEQVLM
KYASFRMRSGKSVHGMVTRLEWLSTSKDQSHYRLTLSSRLALLGYTRQCAVYQNQSVPEV
VEQVLRKHGLEGPDFEFRLEHTYPPREIITQWQETDLQFIQRILSEVGIYWRTMMDDVRD
LDTYIFADSQLNYQFDVRLPYSEPSGLFDGAAESVWDVRTWHNIATGTVVTRDYNYRTAT
TPMDAAVSVRSDAVTTGEHYRYAAPYREAGDDASPEPETESGAFYARLHHERELNRSARI
HLFSNAAHLTPGQVLEPQGDVITALQEGVFLTLVTFRGARDSRLHVSVWGQPYTERYCFR
PVEIPRPVIPGTLPARIESREKNDTYAHLDEQGRYRVKLDFDREGTESGYGYLWLRMAKP
YAGDTLGWHTPLTDGTEVAIAYSNGDIDLPYIAYALHDSEHPDHVNRDNHTRNVLRTPAN
NKLRMEDRRGEEHIKLATEYGKTQLNSGHLVNSKGETRGRGAELRTDEWGTLRAGKGLFV
SADAQAKAQGEVLDMSAALEEIDRLNQQLQQMEIAAEQAQALKADVDSQIRMFEQRLKPL
SEALLMSAPEGMALTSGEHMQMTATKNVAINAGGDASIGAMGNMTALAGDKLGLFARTGQ
LSMKASEGPVEMQAQNAAMRLFAEKKLTMSSASDISFAGKKRITLVGGGSYLRLEAGKVE
YGTTASYLRKVKRTMAASASAKPVQAVSLPPPATMREFNPETLAPWVTPVYAKSCLKEKG
CTDAGTAEEPVDNFGQMTIFAQPVEDDCCGYGHQHEHADDEVVQHAQSAKKRKPDAGGEN
APAQATAAPLALGAATGLMTQVWGEWSLTGALGAARGIPYVGAMMSALYVPSAGEGSDRV
PGRDEFWYEEELRQKSLTGAKATTRVRFFWRQDEQGNMRVYGVHTGEGTPYEGVRTAEMK
WVEKNSRYEFKPAHGADVPLITWTPERPEGGDLPAHTGSDIKPIDQATILVTPIPDGKDE
YTTPPFPMPEERDLNDYILVFPAGSGIKPVYVYLKDDSRNQPGTATGNGVKLSGDKPWLD
LSVTNKGNGAPIPSHIADKLRGRSYGSFDDLREDLWEEISNDPKLMAQFGEDNQERISNG
LAPWVPSDGYYHGPNEVVKKFQIHHDQAIEDGGGVYDLDNLRIVTPRLHDEIHYRR
NT seq 3591 nt   +upstreamnt  +downstreamnt
atggataactggttagcgctttttgacggacagacccgatattttctggatatcaatgac
agttcagtgaagccggatgttctgcgcttttacggcagggaagcactgagcgaaccattc
cgctgggacatcgagttcaccacgcttcaggcgaatatccccccggaacaggtgctgatg
aaatatgcctccttccggatgcggagcggcaaaagtgtgcacggcatggtgacccgcctg
gaatggctttccacctcaaaggaccagtctcactaccgtcttacgctcagttcgcgcctg
gcactcctgggatacacccgacagtgcgcggtatatcagaaccagtccgttcctgaggtg
gttgagcaggtgctgcgtaaacacggtctggaaggtccagattttgaattcagactggag
catacgtacccgccgcgtgaaattatcactcagtggcaggagacggatctgcaattcatc
cagcgtattttgtctgaggtgggaatttactggcgcacgatgatggacgatgtgcgcgat
ctggatacgtacatttttgccgacagccagcttaactaccagtttgatgtgcgcctgccg
tacagcgagccatcgggtctgttcgacggcgcggcagaatcggtctgggatgtgcggacc
tggcacaacatagccaccggcactgtcgtcacgcgggattacaactaccggaccgccacc
acgccgatggatgcggcggtgagtgtgcgcagtgatgcggtcaccaccggggagcattac
cgctacgcggcaccttatcgtgaagcgggcgatgacgccagcccggagccggaaaccgaa
tctggcgcgttctacgcccgacttcaccacgagcgggagctcaacaggtcggcccgcatt
cacctgttcagcaatgctgcacacctcactcccgggcaggtgctggagccgcagggcgac
gtcattacggccctgcaagaaggcgtgttcctcacgctggtgaccttccgtggcgcccgt
gattcccgtctgcatgtgtcagtctggggccagccttacaccgaacgttactgcttccgt
ccggtagagatccctcgcccggtcatcccgggtacgcttccggcccggatcgaaagtcgc
gaaaaaaatgatacctacgcccacctggacgagcaggggcgctatcgggtgaaactggac
ttcgaccgggaggggacggaatccggttacggttacctgtggctgcggatggcgaagccg
tacgccggtgacacgctgggctggcatacgccgctcaccgacggaaccgaagtggcgatt
gcgtacagcaacggtgatattgacctgccgtacatcgcgtatgcgcttcacgactcagaa
catccggaccatgtgaaccgggacaaccacacccgcaacgtgctgcgcaccccggcgaat
aacaagctgcggatggaagacaggcgcggggaagagcacatcaaactcgccacggagtac
ggcaagacgcagctcaacagcgggcacctggtgaacagcaagggagagactcgcggcaga
ggcgcagagctgcgcaccgacgagtggggaacactgcgagccggaaaggggctgtttgtc
agcgccgacgcgcaggcgaaggcacagggcgaggtgctggatatgagcgccgcgctggag
gaaatcgacaggctcaaccagcagttgcagcagatggaaatcgcggcagagcaggcgcag
gcgctgaaggcggatgtggacagccagatacggatgtttgagcagcggctgaagccgctc
agtgaggcgctgctgatgtccgccccggaagggatggcgctgaccagcggggagcatatg
cagatgacggccacgaaaaacgtcgcgataaatgcgggcggcgacgcaagtatcggtgcg
atgggcaatatgacagcgctggccggagataaactggggctctttgcccgtacgggccag
ctgagcatgaaggccagcgaaggtccggtggaaatgcaggcgcagaatgcggctatgcgg
ctgtttgcggagaagaagctgacgatgagctcagcgagtgacatctcgtttgccgggaag
aaacgcatcacgctggtcggtggcgggagttatctgcggctggaggcgggaaaggtcgag
tatggtacgacggcgtcttatttacgcaaagtgaagcggacgatggctgcatcagccagt
gctaaacctgtgcaagccgtatccttgccgcctccggcgaccatgcgagaattcaatccc
gaaacgctcgccccctgggtgacgccggtgtatgcaaaatcctgcctgaaggagaaaggc
tgcacggatgccggaactgccgaagagcccgttgataattttggacagatgacaattttt
gcccagcctgttgaggacgactgctgcggttacggtcatcagcatgagcatgcagatgat
gaagtcgttcagcatgcacagtcagccaaaaaacgtaagcctgacgccgggggcgaaaat
gctccagctcaggcaacggctgccccgcttgctctgggagctgctactggcttgatgacc
caggtctggggggaatggtccctgaccggcgcattgggcgcggcccggggaattccgtat
gtaggcgcgatgatgtccgcgctctacgttccttctgcgggtgaggggagtgacagggtt
cctgggcgagacgagttctggtacgaggaggaactgcggcagaaatccctcaccggagca
aaagcgacaacccgggtgagattcttctggcgacaggatgagcagggcaacatgcgggtc
tacggcgttcatacgggggaaggcaccccgtatgaaggtgtgcgcacggctgaaatgaag
tgggttgaaaaaaatagccgctatgagttcaaaccagctcacggagctgatgttcctctg
attacctggacgcccgaacgaccggagggcggcgatttacccgctcatacaggaagcgac
ataaaacccatcgaccaggctacgatactcgtcacgccaataccagacggaaaagatgaa
tacacgacgccgccattcccgatgccggaagagcgggatcttaacgattacattctggtg
ttccctgccggttccgggattaagccggtttatgtttatctgaaagatgattcacgaaat
caacccggaacagctactggcaacggtgtaaaactatccggagataaaccctggctagat
ttatccgtaacaaacaagggaaatggagccccaattccaagtcatattgctgataagtta
agaggtagaagttatggatcttttgacgatctaagagaagatttatgggaagagataagt
aatgacccaaaacttatggctcagtttggtgaagataaccaagaacgtattagtaatggg
ctagcaccttgggttccatcagatggatactatcatgggccaaatgaggttgttaaaaaa
tttcagatacatcatgatcaagcgattgaagatggcggtggtgtttatgatttagataat
ctaagaatcgtcacccctcggttacatgatgagattcactataggaggtaa

DBGET integrated database retrieval system