KEGG   Salmonella enterica subsp. arizonae: SARI_02612
Entry
SARI_02612        CDS       T00627                                 

Definition
(GenBank) hypothetical protein
  KO
K11891  type VI secretion system protein ImpL
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
ses03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ses00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SARI_02612
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ses02044]
    SARI_02612
Secretion system [BR:ses02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SARI_02612
SSDB
Motif
Pfam: IcmF-related IcmF_C IcmF-related_N
Other DBs
NCBI-ProteinID: ABX22469
UniProt: A9MMZ4
Position
complement(2532006..2535377)
AA seq 1123 aa
MAKVKVKTLIGSVVTVAFFLTVIVAFLFYAFPENVASATGFGPYDGQRILTFCTILVAAL
FLFGWLIEKAFDFAGRSGLYFHWGQKKAQMVVPATGTIASEDDEEEPVFSEDAVSEHLRF
RYGRRWQRKVRLLLVMGNPDDVQKAAPGLCHDLWQEGDGNVLIYGGDAQSLPDEIFLSKL
KRLRSGQPVDGIIQVMSTSALPTDSERDAFLRFRQKADHQLGWQAPVWLWLTDKAKGAQQ
DADTAATGVIFGPEGTIEEADKALTTLSQRLQKAGMAQILNNPAHNGLLQLSSRLQHELK
ARLTVLLSGLMQGSAAFRLRGVMFSPELAATGTVPNTRLDTPVWKAVIDDCNAVSAKKLG
YDWLKVLRLILLALIVLWGAGTQLSLIVNRTQIYQAQETARQAADTAKPLAERLHNQLVL
QQAIARLQHREATGAPWYTRFGLNQDSDTLAALWPLYAKNNAQLMRDATADYLRQQLNAF
VQLPPASDARTQGTQHTYDVLKSYLMLARPDKADASWLAKNVLVAWPKRQNVPDGTWQEM
APKLLGFYAQNLPEHPEWKIKSDAELISTVRQILLKQIGQRNAESGLYQDMLKRVASNWP
DLTLADMTGDTDASTVFSTDEVVPGMFTRQAWEEQVQDAIDEVVKTRRDEIDWVLTDKTH
QPGSDISPEALKARLTERYFTDFGNAWLNMVNSIQWQEASSLSEAIAQLNLIGDIRQSPL
VALMNTLNYQGKTGQKGGLLADSIVDSAKKLIGQKKNARQFIEQTRGPEGPLDGVFGPLM
GLMEGKEGTGANGNLSFQSWLARVTQVRLKLQQVTSAPDPQAMSQMLAQTVFQGKAIDLT
DTRDYGSLFAASLGQEWNGFGQSLFVQPLDLAWRQVLAPAAGSLNARWQSTIVEQWNKAF
AGRYPFKATGSDASLPLLAQFLRSDSGRITTFLKTNLGGILHQEGNRWVVDPSASQGMVV
SPDFLLAINQLAELSDIVFSQGDAGVHFELMARPSRDVARVQLTLDEQNLDYFNQMESWQ
SFTWPGNTYYPGVSLSWRSVNSGMQLYANNQGNWGFIRLLDKALITPLDASRTQLVWITA
DGNPLKFVMRSELGDGPLALLKLQGFTLPGSIFNVAAGTEGVE
NT seq 3372 nt   +upstreamnt  +downstreamnt
atggctaaggtaaaagtaaaaacactcatcggctccgttgtgactgtcgccttttttctg
acggtcatcgtggcatttctgttttatgcctttccggaaaacgtggcttcggccaccgga
ttcggtccgtatgacggccagcgcatactcacattctgcaccatactggttgccgcgttg
tttttattcggctggctgattgagaaggccttcgacttcgccggtagatcggggctgtat
ttccactggggtcagaaaaaggctcagatggtcgtcccggcaacaggcaccattgcgagc
gaagatgatgaagaagagcctgtcttcagtgaggatgccgtatccgagcacctccgtttc
cgctatggccgtcgctggcagcgtaaagtgcgactcctgctggtgatgggtaatccggac
gacgtccagaaagcagccccgggtctgtgccatgacctctggcaggaaggtgacggcaac
gtactgatttatggcggtgatgcgcagtcacttccggatgagatcttcctttcaaaactg
aaacgcctgcgatcaggccagccggttgatggaattattcaggtgatgagtacttcagcc
ctcccgacggatagcgaacgggatgctttcttgcgtttccgccagaaagccgatcatcag
ctgggctggcaggcgcctgtctggctgtggctgactgataaagccaaaggtgctcagcag
gacgcggacacggctgcgacaggggtgatattcggaccggaaggcactatagaagaggcg
gataaggcattgactacgctgtctcagcgcctgcaaaaagccggtatggcacagatactg
aataatccggctcataacggcctgctccagttatcttcccgtctgcagcacgaactgaaa
gcccgtctgaccgttttgctcagcgggctgatgcagggatctgcggcctttcgtttacgg
ggggttatgttcagtcctgaactggccgctaccggaacggtgccgaacacgcgcctcgac
acaccggtgtggaaagccgtcattgatgactgtaatgccgtcagcgcaaaaaaactgggc
tatgactggctgaaagtgctacggctcatcctgcttgctctgattgtgttatggggtgca
ggtactcagctgtcactcatcgttaaccgtacccagatttatcaggcacaggaaacggcg
aggcaggcagcggataccgcaaaaccacttgctgaacgcctgcacaaccagctcgtactc
cagcaagctattgcccgtctgcaacatcgtgaggcgaccggcgccccatggtacacgcgt
tttggtcttaatcaggacagtgacacgctggctgctctctggccgctgtatgcgaaaaac
aacgcacagctgatgagggatgccaccgcagattatctcaggcagcagctgaatgcgttt
gtgcaactccctcctgccagtgatgcccgtacgcagggtacacagcacacctatgacgtg
ctcaaaagttatctgatgctggcccgtccggataaagcggacgcgagctggctggcaaaa
aacgtactggtagcctggccgaagcgtcagaatgtgccggatggcacatggcaggaaatg
gcgccgaaactactgggtttttatgcgcagaacctcccggaacatccggaatggaaaatt
aagtccgatgctgaactcatcagtacggtacgtcagatcctgctcaaacagataggccag
cgtaacgccgaatccgggttgtaccaggacatgcttaagcgcgttgccagtaactggcct
gatttaacgctggcggacatgaccggtgataccgatgcctcaacggtattcagcactgac
gaagtcgttccgggaatgtttacacgccaagcctgggaagagcaggttcaggatgcaatt
gatgaggtggtcaaaacccggcgtgacgaaatcgactgggttctgacggataaaacccat
cagcccgggagtgatatttccccggaagcgctgaaggcccgtctgacagaacgctatttt
accgattttggtaacgcctggctgaacatggtcaacagcattcagtggcaggaagcttcg
tcactttctgaggcgattgcccagcttaatctgatcggtgatatccgccagtcgcctctg
gttgcactaatgaacacgctaaactaccagggaaaaaccggacagaagggcgggctactt
gccgactcgatagtggattcagcgaaaaagctgatcggtcagaaaaaaaatgccagacag
tttatagagcagacccgggggcctgaaggcccgcttgatggggtgtttggtccgctaatg
gggctgatggaagggaaagagggtacaggtgctaacggtaaccttagcttccagtcctgg
cttgcccgcgttacccaggtgcggctgaagcttcagcaggtcaccagcgcaccggatccg
caggctatgtcgcagatgctggcccagaccgtgttccagggcaaagccatcgacttgacc
gacacccgcgattacggcagtctgtttgcggcaagcctgggccaggaatggaacggattt
ggacagtcattgttcgtacaaccgttagatctggcgtggagacaggttctggctccggca
gcgggaagcctgaatgcacgctggcagtcgaccattgtcgagcagtggaataaggccttt
gcgggacggtacccgtttaaagccaccggtagcgatgcttccctgccgctactggctcag
ttcctgcgtagcgactcgggtcgaatcactaccttcctgaaaacgaatctcggcgggatc
ctccaccaggaagggaatcgctgggtcgttgatccttccgcaagtcaggggatggttgtc
agtccggattttctcctggcgattaatcagctggcggaactctcagatatcgtgttctct
cagggcgatgcaggtgttcacttcgagttgatggcgcgtccttcacgggatgttgccaga
gtgcagcttaccctcgatgagcagaacctggattacttcaatcagatggaaagctggcag
agcttcacctggccggggaatacgtactatccgggcgtgtcactcagctggcgaagtgtc
aacagcggtatgcagctctatgcaaacaaccagggtaactggggtttcattcgcctgctg
gacaaagccctgatcactccactcgatgccagccgtacacagctggtgtggatcaccgcc
gatggcaatcctctgaagtttgtgatgcgcagcgagctcggcgacggtccgcttgcctta
ctgaagctacagggatttacgctaccagggtccatttttaacgttgccgctggcaccgaa
ggcgttgagtaa

DBGET integrated database retrieval system