KEGG   Salmonella enterica subsp. arizonae: SARI_02626Help
Entry
SARI_02626        CDS       T00627                                 

Definition
(GenBank) hypothetical protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
ses03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ses00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SARI_02626
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ses02044]
    SARI_02626
Secretion system [BR:ses02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SARI_02626
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_GPD DUF2345 T6SS_Vgr
Motif
Other DBs
NCBI-ProteinID: ABX22483
UniProt: A9MN08
Position
complement(2547387..2549744)
Genome map
AA seq 785 aa AA seqDB search
MSSFLSNKATSLVHQLLGQSRYRVDVHECSHFLDVLRYSAVESLSQPWRYDVAVTCTSAD
IACDTLLLKPASFTFQTPVFDGTPALPVRTVFGVVESFRRVSTSNDETHYALTIVPRIAL
LGYTKGSEIYLNQSVIEVVEQVLRKHGLEGPDFEFRLSREYPSRELITQWRETDLEFIQR
LLAEVGIYWRYEMDSRLEQDVVIFQDSQQQYEFGVTLPLRNQAGMSDSGQESIWDIQTAY
NVVSGSVATRDYNYRDALTPQDSAESIFSKEGITTGETYHYAEPFLTAGDADSPETGAYF
ARLRHERILNAQYRVSGHSSSPHLAPGQVLETDGTLPDAVKDGIVITTVRTSGSRKSSFT
MTFEGIPYSETVCWRPALLNRPVISGSLPARVESTQKGDTYSWLDPQGRYRVKLDLDRNS
PEQGYAYLWLRLAKPYAGDTYGFHSPLIDGTEVAVVFDGGDPDRPYIAYALHDSEHPDHV
TSDNHTRNVWRTPANNKLRMEDKRQEEHIKLATEYGKTQLNMGHLVNSQREKRGAGFELR
TDEHGAVRAAKGLFLTADAQAKAQGPVLEMAPAINQINQANSQMQALNSAAEAAGALVSD
ISTQVNLVRDRLKDLQSAVLLASAPQGVAFTSGEHLQLSSARNTMINAGQHLDIGAMKNL
SVSVEKALGMFVHKGGAKVVANQGDIELQAQHNTMALFSEKQLTVTSSEDEIIISTPETL
TLNGGGSYLRLSKNGIEHGSEGIMVMKVASYLVPGTGASQQMETPDFKTTDVTVTRKNSA
KWTSE
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtttcctctccaacaaggctaccagcctggtacatcagcttttagggcaatca
cggtaccgggttgatgtgcatgaatgcagccatttcctggatgtgttgcgttacagtgcg
gtggagtccctcagccagccctggcggtatgacgtggcggtgacctgcacctctgcggat
atcgcctgcgacacgttactgctgaagccggcgtcattcactttccagacccccgtgttt
gacggaacaccggccctgcctgtaaggacggtattcggcgtggttgagtcgtttcgccgc
gtgtctacctcgaatgatgagacccattacgcgctgacgatcgttccccgtattgccctt
ctgggctatacgaaagggagcgagatctacctcaatcagtcggttattgaggtggttgaa
caggtattgcgtaaacacgggctggaagggcctgattttgagttccggctctcccgggaa
tatccctcccgggagctcattacccagtggcgggaaactgaccttgagtttatccagcgc
ctgctggcggaggtgggcatttactggcgctatgaaatggacagccgtcttgaacaggac
gttgtgattttccaggacagccagcagcagtatgaatttggtgtcacgctgccattacgc
aaccaggccgggatgagtgacagcgggcaggagagcatctgggatattcagaccgcatat
aacgtggtaagcggaagtgtggccacccgtgactacaactaccgtgatgcactgacgcct
caggacagcgccgaaagtattttcagcaaagaggggatcacgaccggggaaacgtatcat
tacgcggaacccttcctgacggcaggtgacgctgatagcccggagaccggggcatacttc
gcccgcctgcgtcacgaacgcattctgaacgcgcagtatcgcgtcagcgggcattcctcc
agccctcatctggcgccggggcaggtactggaaacagatggcacgttgccggatgcggtg
aaagacggaattgtcatcacgaccgtacgtaccagcggttcacgcaaaagtagctttacg
atgacgtttgagggtatcccctatagcgaaactgtctgctggcgccctgcgttgcttaat
cgcccggtgatatccggatcgctcccggcccgggtggaaagcacacagaaaggcgacacc
tattcctggctcgatccgcagggccgctaccgtgtgaaactggaccttgaccgcaacagt
cctgaacagggttatgcctatttgtggttgcggctggctaagccctatgccggggatacc
tacggattccactcaccgcttatcgacggaactgaagtggccgtagtatttgacggcgga
gatccggatcgtccctacatcgcttatgccctgcatgactcagaacatccggaccacgtc
accagtgacaatcatacgcggaatgtgtggcgcaccccggcgaacaataagctgcggatg
gaggataagcgccaggaagagcatatcaagctcgcgacggaatacggcaaaacgcagctg
aacatggggcacctggtcaacagccagcgtgaaaaacgcggcgccggttttgaactgcgt
acggatgagcatggcgcagttcgtgcagcaaaaggcctcttcctgacagcagatgcgcag
gccaaagcgcaggggccggtgcttgaaatggccccagccatcaaccagattaaccaggcc
aacagccagatgcaggcgctgaacagtgccgcagaagcggccggagcgctggtatccgat
atcagcacccaagtcaacctggtcagggacaggctgaaggatcttcagtcggcggtactg
ctggcgagcgccccgcagggcgtggcatttacctcaggtgaacaccttcagctcagcagc
gcccgcaacacgatgattaatgcaggccagcaccttgatatcggagcgatgaagaatctg
tccgtgagcgtggaaaaagccctgggaatgtttgtgcataaaggcggggcgaaggttgtc
gccaaccagggagacatcgagctccaggctcagcacaataccatggcattgttttcagaa
aagcagttgacggtgaccagtagcgaagacgaaattattatcagcaccccggaaacactg
acgcttaacggtggtgggtcatatctgcgcctgagtaagaacggaattgaacatggatct
gaggggataatggtgatgaaggttgcgagctacctggtgccgggcacaggtgccagccag
cagatggaaacaccggactttaaaacgacggacgtgacggtcacaagaaaaaactctgcc
aaatggacgagtgaataa

DBGET integrated database retrieval system