KEGG   Salmonella enterica subsp. arizonae: SARI_02734Help
Entry
SARI_02734        CDS       T00627                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
ses  Salmonella enterica subsp. arizonae
Brite
KEGG Orthology (KO) [BR:ses00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ses02044]
    SARI_02734
Secretion system [BR:ses02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SARI_02734
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VipA
Motif
Other DBs
NCBI-ProteinID: ABX22590
UniProt: A9MPE7
Position
complement(2649059..2649595)
Genome map
AA seq 178 aa AA seqDB search
MKTIHSDKPRDDEMADSFQNEVPKARINLKLDLHTGGASKKTELPLKLLVAGDFSNGQES
APLSERKKVNLNKNNFDSVLSEYSPNVNLTVKNTLADDGSEDNISLTFRSMKDFSPEQVS
RQIPQLKAMLSMRNLLRDLKANLLDNQAFRKELEKILLDPALSAELRTELSALAPKQP
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaacgatacacagcgataaaccgagggatgatgagatggccgacagtttccagaat
gaagtgccaaaggcacgtattaatctaaaacttgacctgcataccgggggagccagcaag
aaaacggaactccctttgaaattactggtggcgggcgacttcagtaacggtcaggagtct
gcaccactgtctgagcgaaaaaaagttaatttgaataaaaataacttcgactcagtgctt
tccgaatattccccaaacgtcaatcttaccgttaaaaacacgctggctgatgacggtagc
gaagacaatatcagtctgaccttccggagcatgaaggacttctcgccggaacaggtttcc
cggcaaatccctcagttgaaggccatgctttccatgcgcaatttactccgtgacctcaag
gccaaccttttagataaccaggcgttccgaaaggaactggaaaaaattctgctcgacccg
gcgttaagtgcagaactccgcacagagctgtctgctctggccccgaaacagccataa

DBGET integrated database retrieval system