KEGG   Salmonella enterica subsp. arizonae: SARI_02950Help
Entry
SARI_02950        CDS       T00627                                 

Definition
(GenBank) hypothetical protein
  KO
K02968  small subunit ribosomal protein S20
Organism
ses  Salmonella enterica subsp. arizonae
Pathway
ses03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ses00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SARI_02950
Ribosome [BR:ses03011]
 Ribosomal proteins
  Bacteria
   Small subunit
    SARI_02950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S20p
Motif
Other DBs
NCBI-ProteinID: ABX22796
UniProt: A9MR48
Position
2878761..2879024
Genome map
AA seq 87 aa AA seqDB search
MANIKSAKKRAVQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKAAALKAFNEMQPIVDR
QAAKGLIHKNKAARHKANLTAQINKLA
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
ttggctaatatcaaatcagctaagaagcgcgccgttcagtctgaaaaggctcgtaagcac
aacgcaagccgtcgctctatgatgcgtactttcatcaagaaagtatacgcagcaatcgaa
gctggcgacaaagctgctgcactgaaagcatttaacgaaatgcaaccaatcgtggaccgt
caggctgctaaaggtctgatccacaaaaacaaagctgcacgtcataaggctaacctgact
gcacagatcaataaactggcttaa

DBGET integrated database retrieval system